Details for Kale Locus Bo5g148280

Position : C5 ( 5`- 45645901 .. 45650046 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148280

Protein [Map View]
MYTLLLKPTYPLSACLYIKPTICSHSIRQLKSFLPIRYLITSLPITMDINYSPLGFLISLFFIVTFLAPQVKSRAFYVFG
DSLVDNGNNDYLVTTARADNYPYGIDYPTRRPTGRFSNGLNIPDIISEAIGMPSTLPYLSPQLTGENLLVGANFASAGIG
ILNDTGIQFVNIIRIFRQFEYFQQYQQRVSALIGPEATQQLVNQALVLITLGGNDFVNNYYLIPFSARSRQFTLPDYVVY
LISEYGKILRKLYELGARRVLVTGTGAMGCAPAELAQHSRNGECYGALQTAAALFNPQLVNLIASVNAEIGQDVFVAANA
YQMNMDYLTNPEQFGFVTSKVACCGQGPYNGIGLCTPISNLCPNRDLYAFWDAFHPTEKANRIIVNQILTGSSKYMHPMN
LSTVMLLDSSRI*

DNA
ATGTATACGTTACTATTGAAACCTACATATCCATTGTCAGCGTGTCTATATATAAAACCCACCATATGCTCTCATAGTAT
TCGTCAACTTAAATCCTTTCTCCCCATTCGTTATCTAATCACATCTCTGCCCATAACTATGGATATTAATTATTCTCCAC
TAGGGTTTCTAATATCACTCTTCTTCATTGTTACTTTTCTTGCACCACAAGTTAAATCTAGGGCTTTCTACGTCTTTGGT
GATTCTCTGGTCGACAATGGAAACAACGATTACCTTGTCACCACTGCTCGCGCCGACAATTACCCGTATGGTATCGATTA
CCCGACCCGTCGACCCACTGGGCGTTTCTCTAACGGCCTCAACATCCCCGACATTATCAGTGAAGCTATAGGCATGCCGT
CGACTTTGCCGTACCTTAGCCCGCAGCTCACCGGAGAAAATCTTCTTGTCGGTGCTAATTTTGCCTCCGCTGGAATTGGA
ATCCTCAACGACACTGGAATTCAATTTGTAAACATAATTAGAATATTTAGACAGTTCGAATACTTCCAACAGTACCAGCA
ACGAGTGAGCGCATTGATCGGACCAGAAGCTACACAACAGCTAGTTAATCAAGCTCTTGTCTTAATCACACTCGGTGGCA
ACGATTTCGTCAACAACTATTATCTCATTCCTTTCTCTGCTCGCTCTCGCCAGTTCACATTACCGGACTACGTTGTTTAT
CTCATTTCCGAATACGGAAAAATCCTTAGGAAACTCTATGAGTTGGGTGCAAGACGGGTTCTAGTAACCGGAACTGGTGC
AATGGGATGTGCACCTGCGGAGCTGGCTCAGCATAGCCGAAATGGCGAATGCTATGGTGCTCTCCAAACAGCAGCCGCTT
TGTTCAATCCGCAATTAGTTAATTTGATCGCATCAGTCAATGCTGAGATCGGTCAGGACGTTTTTGTAGCAGCCAATGCC
TATCAAATGAACATGGATTATCTAACTAACCCAGAACAATTCGGGTTTGTGACATCAAAGGTGGCATGTTGTGGACAAGG
ACCGTACAACGGCATAGGACTATGCACTCCAATCTCGAACTTATGTCCAAACAGAGATTTATATGCATTTTGGGATGCGT
TCCATCCGACAGAGAAAGCTAATAGGATCATTGTTAATCAGATCCTCACTGGTTCCTCCAAGTATATGCACCCAATGAAC
CTTAGTACCGTCATGCTCTTGGATTCTTCTAGAATCTAA