Details for Kale Locus Bo5g148270

Position : C5 ( 5`- 45641531 .. 45641892 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148270

Protein [Map View]
MNIVIEHNPSSIKLSELGVMSWPKWSCQPGKYALVFEERETCYLVKGKVKVYPKGSSSEFVEFGAGDLVTIPKGLSCTWE
VSLFIDKHYQFDPPT*

DNA
ATGAATATCGTAATCGAACACAACCCTTCAAGCATAAAGTTATCTGAACTTGGAGTCATGTCATGGCCTAAGTGGTCTTG
TCAGCCGGGGAAGTATGCATTGGTGTTTGAAGAAAGAGAGACGTGCTATTTGGTGAAGGGAAAAGTGAAGGTGTATCCAA
AAGGGTCATCATCAGAGTTTGTAGAGTTTGGTGCAGGAGACCTTGTCACCATCCCCAAGGGACTTAGCTGCACTTGGGAA
GTATCTCTTTTCATCGACAAACACTACCAGTTCGATCCTCCTACTTAA