Details for Kale Locus Bo5g148260

Position : C5 ( 5`- 45635931 .. 45640748 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148260

Protein [Map View]
MENIEFDDKSFLPDSAKNVDKGGYKSWMVGDIDFNSTGSKYGGWDDLDKRVEIPSNENVRTKQQFNEKPLLLRRLVAAFP
FLSSWTKLLF*

DNA
ATGGAGAACATAGAGTTTGATGATAAGAGTTTTCTTCCAGATTCCGCAAAAAATGTGGATAAGGGAGGATACAAGTCATG
GATGGTAGGGGATATTGATTTTAACAGCACAGGTTCTAAGTATGGAGGTTGGGATGATCTAGACAAGCGAGTTGAGATTC
CTTCAAATGAGAATGTTCGTACAAAGCAACAGTTCAATGAGAAGCCATTGCTCTTGAGGAGGCTAGTTGCTGCTTTCCCC
TTTTTGAGTTCATGGACCAAATTGTTATTTTGA