Details for Kale Locus Bo5g148250

Position : C5 ( 5`- 45634013 .. 45635096 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148250

Protein [Map View]
AKTKESVIQFVSKPLVYALFCIAIGFSPVHSFQAPALALPFISDVIRKRKKETLIEKEVVLKSIDHEFSGYTQRLLEMVS
VLLKSVEKVRKEDGDAAEVGAALDAVKEEKEKLEKEIMSGLYSDLGRFRKEREMLMERADGIVEEVLRLKKESERMLGKG
NKEKAERLEDSVDVMEREYNKIWERVDEIDDTVLKRETTTLSFGVRELMFIERECVELVKSFNREMKQKNSESIPESSVT
KLPRDEIKQELLNAQRKHLEQVILPDVLELE

DNA
GCAAAGACGAAAGAGAGCGTGATACAGTTTGTATCCAAGCCGTTAGTTTACGCTTTGTTCTGTATTGCAATCGGGTTTTC
ACCGGTTCACTCGTTTCAAGCTCCGGCTTTAGCTCTGCCCTTTATTAGCGATGTGATACGGAAGAGAAAGAAAGAGACTT
TGATTGAGAAAGAGGTTGTTTTGAAGTCAATTGATCATGAGTTCTCTGGTTACACTCAGAGACTGTTGGAGATGGTTTCG
GTTCTTCTCAAGAGCGTTGAGAAGGTGAGAAAGGAGGACGGAGATGCTGCAGAGGTGGGAGCGGCTTTGGATGCGGTGAA
GGAGGAGAAGGAGAAGCTTGAGAAAGAGATAATGAGTGGGTTGTATAGTGATTTGGGTCGGTTTAGGAAAGAGAGAGAAA
TGTTGATGGAACGAGCAGATGGGATTGTGGAAGAGGTTCTGAGGTTGAAGAAAGAGAGTGAAAGGATGTTGGGGAAAGGG
AATAAGGAGAAAGCGGAGAGATTGGAAGATAGTGTGGATGTGATGGAGAGAGAGTACAACAAGATATGGGAGAGAGTAGA
TGAGATTGATGATACGGTTTTGAAGAGAGAGACGACGACTTTGAGTTTTGGGGTTAGGGAGCTTATGTTCATTGAAAGAG
AGTGTGTGGAGTTGGTTAAGAGCTTTAACAGAGAAATGAAGCAAAAAAATTCTGAGAGTATTCCTGAGAGCTCCGTTACG
AAACTCCCAAGAGATGAGATTAAGCAGGAATTACTGAACGCTCAAAGAAAGCATTTGGAGCAAGTGATACTGCCTGATGT
TTTGGAACTTGAG