Details for Kale Locus Bo5g148230

Position : C5 ( 5`- 45628466 .. 45629608 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148230

Protein [Map View]
MVRLKFACPVLEINLISAQDLAPISKNMKTYSVAWINTDPMRKLTTRVDQANRSNPIWNKKFVFRVDDKILDVDASSIVI
EIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDGGGGGNNNMRLVTLQIRRPSGRLQGFLRLGVALLDGGQRSMPLSVE
VFDGSRRDSKRGDAKMMHRRTNSDQTDLSTSTNDYGVKTGVVTGGGGSGGGGGVDSMVNGSLCSSDIGPSASVVAAAIAQ
GLYNRQKTTVKAVAGKEDASSILEGKTEGIEHRVERWRAEKSAGRAVEAAGSSDDSSGKGGGGRRQRRRRRRRKEKQRRR
NGEGKKGLFSCFGNVFGCEISITCGGGSGGGEGDSTKKKYNNNKVVNLSAVDETFSHSAT*

DNA
ATGGTTCGGCTCAAATTCGCATGTCCCGTCCTCGAAATCAACTTAATCTCAGCACAAGACCTAGCCCCTATCTCAAAAAA
CATGAAAACATACTCAGTCGCGTGGATCAACACCGACCCCATGCGCAAACTCACGACGCGTGTCGACCAAGCAAACCGAT
CCAACCCTATCTGGAACAAGAAGTTCGTCTTCCGCGTCGACGACAAGATCCTCGACGTCGACGCGTCGTCGATAGTCATC
GAGATCTACGCGGCGGCTTGGGCCAAAGACGCGCTCGTCGGGACCGTGAACGTTCTTCTCAGCGACCTCTTCGCTCCTTG
GTCCGGCTTCGGGGACGGCGACGGCGGCGGCGGCGGGAACAACAACATGAGGCTCGTGACGCTTCAGATACGCCGTCCGT
CCGGGAGGCTTCAAGGCTTTTTGCGTCTAGGCGTTGCGCTTCTCGACGGCGGTCAGAGGAGCATGCCGTTGTCGGTCGAG
GTTTTCGATGGAAGCCGGAGAGATAGTAAGAGAGGTGATGCGAAGATGATGCATCGTCGTACGAATAGCGATCAGACGGA
TTTATCTACGTCGACTAATGACTACGGAGTGAAGACAGGGGTTGTTACTGGAGGAGGTGGTAGTGGTGGAGGTGGTGGTG
TTGATAGTATGGTGAATGGTTCGCTTTGTAGCTCTGATATAGGACCGTCCGCGTCTGTGGTTGCGGCCGCGATTGCTCAG
GGGCTTTACAACAGACAGAAAACAACGGTTAAAGCGGTTGCGGGGAAGGAGGACGCGAGTTCGATACTCGAAGGGAAGAC
GGAAGGGATTGAGCATAGAGTTGAGAGGTGGAGAGCGGAGAAAAGCGCGGGTAGGGCGGTTGAAGCGGCTGGATCGAGCG
ATGATTCTAGCGGGAAAGGAGGAGGAGGGAGGAGGCAGAGGAGGAGGAGGAGGCGGAGGAAGGAGAAGCAACGGAGGAGA
AACGGCGAAGGTAAAAAAGGGTTGTTCTCGTGTTTTGGAAACGTGTTTGGATGTGAGATTTCGATTACTTGCGGCGGTGG
GAGCGGCGGAGGAGAAGGAGACAGCACGAAGAAGAAGTATAATAACAATAAAGTAGTGAATCTTAGTGCTGTAGACGAAA
CGTTTAGTCATTCTGCGACTTGA