Details for Kale Locus Bo5g148190

Position : C5 ( 5`- 45610373 .. 45612010 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148190

Protein [Map View]
MNNPVPCQVFPLASGGTSSGYCNGTYVSSHERSSSQTRQSVETQPLPVTNQPQGQRDMSWPEDQLQGFFDFPPQAESSRA
KSEWPDWANQMISVDDGLEPNWSELLGDPNVLNQDSKIPTPSCDIARQEIVVSTQHQVDPSSAKSPQASSMTSKQRMRWT
PELHEAFVDAINQLGGSERATPKAVLKLINSPGLTIYHVKSHLQKYRTARYKPEISVDTEKPPLKTLKTIEDIKSLDLKT
SIEITEALRLQMEVQKKLHEQLEVQRTLQLQIEEQGRYLQMMIEKQQQKMQEKKIGSSSGTSTMPEADTSSAPSPDLSQV
SITERLQSGSGTLDQSGSPSLATKKRVRED*

DNA
ATGAACAACCCTGTACCTTGTCAAGTGTTTCCTCTAGCTTCCGGTGGCACTTCTTCTGGATACTGCAATGGCACGTACGT
TTCATCACATGAAAGAAGCTCCTCACAGACCAGACAATCCGTGGAAACACAACCCTTGCCGGTGACTAATCAACCTCAAG
GGCAGAGAGATATGAGCTGGCCTGAAGACCAGCTCCAAGGGTTCTTTGACTTTCCTCCACAAGCAGAGAGCAGCAGAGCG
AAAAGCGAATGGCCAGACTGGGCCAATCAGATGATCTCTGTCGATGATGGTCTGGAACCTAACTGGTCGGAGCTTCTAGG
TGATCCTAATGTCCTCAACCAAGATTCAAAGATACCAACACCGTCTTGTGATATAGCTAGGCAAGAGATAGTAGTCAGTA
CTCAGCATCAGGTGGATCCTTCGAGTGCCAAAAGCCCACAAGCTAGTTCAATGACATCTAAGCAACGAATGCGTTGGACA
CCTGAACTCCATGAAGCATTTGTTGATGCTATCAATCAGCTCGGTGGTAGTGAACGAGCCACACCTAAGGCTGTATTGAA
GCTCATCAATAGCCCAGGGCTGACCATATACCATGTCAAAAGCCATTTGCAGAAATACAGAACGGCTAGGTATAAACCGG
AGATTTCAGTAGATACAGAAAAACCTCCACTGAAGACTTTGAAGACCATTGAAGATATCAAGTCTCTTGACTTGAAGACG
AGCATTGAAATCACTGAAGCTCTACGGTTACAAATGGAAGTTCAGAAAAAACTCCATGAGCAACTTGAGGTCCAAAGAAC
GTTACAGTTACAAATTGAGGAACAAGGTCGGTATCTCCAGATGATGATTGAGAAACAACAACAGAAGATGCAAGAGAAGA
AAATAGGCTCTTCTTCTGGCACATCAACAATGCCAGAAGCTGACACTTCTTCAGCTCCATCACCAGACCTTTCACAAGTG
TCAATAACTGAGAGACTGCAGAGTGGTTCTGGCACATTGGATCAGAGCGGGTCTCCCTCTTTGGCTACTAAGAAACGAGT
TAGAGAAGATTAA