Details for Kale Locus Bo5g148140

Position : C5 ( 5`- 45584190 .. 45585812 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148140

Protein [Map View]
MSIPPSSASSSASQYTYTANSYYSAPYQPPQPFVAPSPAPAPPVATIPGATVYPQPIGPVPAVYSYPQYQSHQLFQRDAQ
TITPEALENVKAALASSETEHKAETKKRAIPRKAAGQSWEDPTLAEWPENDYRLFCGDLGNEVNDDVLSKAFARFPTFNM
AKVIRDKRTGKTKGYGFVSFLNPADLAAALKEMNGKYVGNRPIKLRKSSWKERTDQEAAERQKRHSNKKQKTVKKKSVLH
K*

DNA
ATGTCAATCCCTCCGTCTTCAGCTTCTTCTTCAGCCTCTCAGTACACATACACTGCGAATTCGTACTATTCCGCGCCTTA
CCAGCCTCCACAGCCCTTCGTGGCGCCGTCGCCTGCTCCAGCTCCTCCGGTTGCTACCATTCCCGGAGCTACGGTCTATC
CTCAGCCTATTGGCCCCGTTCCCGCCGTATACTCTTACCCTCAGTACCAGTCGCATCAGTTGTTCCAGAGAGATGCACAA
ACCATCACACCAGAAGCGCTTGAGAATGTGAAAGCCGCTTTGGCTAGTAGCGAAACGGAACACAAGGCGGAAACTAAGAA
GAGAGCTATTCCTCGTAAAGCTGCTGGACAGTCTTGGGAGGATCCTACTCTTGCAGAGTGGCCAGAGAATGACTATCGCT
TGTTTTGTGGTGATCTTGGGAATGAAGTAAACGATGATGTTCTTTCCAAGGCATTTGCTCGATTCCCCACCTTCAATATG
GCCAAGGTCATCAGAGATAAGCGGACTGGTAAAACCAAGGGTTATGGGTTTGTGAGTTTCTTAAATCCTGCGGATCTAGC
TGCAGCCCTAAAAGAAATGAATGGTAAGTATGTTGGGAATCGTCCAATCAAATTAAGAAAGAGCAGCTGGAAAGAGAGAA
CAGATCAGGAGGCTGCAGAAAGACAAAAGCGTCATAGCAATAAGAAACAAAAGACAGTGAAGAAGAAGAGCGTACTCCAC
AAGTGA