Details for Kale Locus Bo5g148130

Position : C5 ( 5`- 45575945 .. 45576538 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148130

Protein [Map View]
MDLISQNHNNKNPNTTLSTQHASSPPPSSRYENQKRRDWNTFCQYLRNHRPPLSPPSCSGAHVLEFLRYLDQFGKTKVHH
QNCAFFGLPNPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGAPDTSPFGSRSVRIFLREVRDFQAKSRGVSYEKKRKRV
NNKQITQSPSQPPLPPQPLEQQQQGQSMMANYHHGAT*

DNA
ATGGATCTGATCTCTCAAAATCATAATAATAAGAACCCTAATACAACTCTCTCGACACAACATGCTTCTTCTCCACCTCC
ATCTAGCCGCTACGAGAACCAGAAACGCCGTGATTGGAACACTTTCTGCCAATACCTTAGAAACCATCGTCCACCGCTCT
CTCCACCGTCTTGTAGCGGCGCACATGTTCTCGAGTTTTTGCGTTACCTTGACCAGTTCGGGAAAACCAAAGTCCACCAC
CAAAACTGCGCCTTCTTTGGCCTCCCAAACCCTCCGGCTCCATGTCCTTGTCCTCTCCGACAAGCGTGGGGCTCACTTGA
CGCTCTTATCGGTCGTCTCCGTGCCGCCTACGAGGAGAACGGTGGAGCTCCCGATACTAGCCCTTTTGGCTCACGTTCAG
TCAGGATTTTCCTCAGGGAGGTTAGAGATTTTCAAGCTAAATCACGTGGCGTTAGCTACGAGAAGAAGAGGAAAAGGGTC
AACAACAAACAAATAACTCAGTCGCCTTCGCAGCCGCCTCTACCGCCGCAGCCACTAGAGCAGCAACAGCAAGGCCAATC
TATGATGGCTAATTACCACCACGGTGCAACTTGA