Details for Kale Locus Bo5g148120

Position : C5 ( 5`- 45571021 .. 45573365 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148120

Protein [Map View]
MVTPVIRTVDLRSDTVTKPTESMRSAMANAEVDDDVLGNDPTAVLLEREVAEIAGKEAAMFVPSGTMGNLISVLVHCDER
GSEVILGDDSHIHIYENGGVSSLGGVHPRTVKNEEDGTMEISSIEAAVRSPKGDLHYPVTKLICLENTQANCGGRCLPIE
YIDKVGELAKKHGLKLHIDGARIFNASVALGVPVRRIVQAADSVSICLSKGIGAPVGSVIVGSKSFITKARWLRKTLGGG
MRQIGVLCAAALVALRENVAKLEDDHKNAKILAEGLNRIERLKVNVAAVETNIIYVDLPKDPKFIAEDACKSLEVLGVLV
IPQTTFRIRIVLHHQISDSDLDYVLSCFEKLFSSVPEEKA*

DNA
ATGGTAACGCCAGTTATAAGAACCGTTGATCTCCGGTCCGACACGGTGACTAAGCCAACTGAGTCAATGCGTTCAGCTAT
GGCAAACGCGGAAGTAGACGATGACGTTTTGGGGAACGATCCAACGGCAGTGCTTTTGGAGAGAGAGGTGGCTGAGATCG
CCGGAAAGGAGGCGGCTATGTTTGTTCCGTCAGGGACAATGGGGAATTTGATAAGCGTGTTGGTCCATTGTGATGAGAGA
GGGAGTGAAGTGATTCTTGGAGATGATTCTCACATTCATATTTATGAAAATGGTGGCGTTTCTAGCCTCGGTGGAGTGCA
CCCGAGAACGGTGAAGAATGAAGAGGATGGGACGATGGAGATTAGTTCTATCGAAGCTGCCGTGAGGAGTCCCAAAGGAG
ATCTTCATTATCCGGTTACTAAGCTTATATGTCTTGAGAACACTCAAGCAAATTGTGGTGGTAGATGCTTGCCAATAGAA
TACATAGACAAGGTCGGAGAGTTAGCCAAGAAACATGGCTTGAAGCTTCACATCGATGGAGCTCGTATCTTCAATGCTTC
TGTTGCACTCGGAGTACCGGTGAGGAGGATTGTTCAAGCCGCTGATTCGGTCTCGATTTGTTTGTCGAAAGGCATAGGTG
CACCGGTGGGTTCGGTAATCGTGGGAAGCAAAAGTTTCATCACTAAAGCAAGGTGGTTAAGGAAAACCTTAGGTGGAGGA
ATGAGACAGATAGGTGTGCTCTGTGCTGCCGCATTGGTGGCTCTCCGTGAAAACGTAGCCAAGCTCGAAGATGACCACAA
GAATGCCAAGATCTTGGCAGAAGGACTGAACCGGATTGAACGGTTAAAAGTAAACGTTGCGGCAGTGGAAACCAACATCA
TATACGTAGATCTACCAAAAGATCCTAAGTTTATAGCTGAAGACGCATGTAAGAGTTTGGAAGTTCTCGGTGTGCTTGTC
ATACCTCAAACTACATTCAGAATCAGGATTGTTCTGCACCACCAAATCTCAGATAGCGACTTGGATTATGTGCTCTCTTG
TTTTGAGAAACTGTTTAGCTCAGTGCCAGAAGAGAAAGCTTGA