Details for Kale Locus Bo5g148100

Position : C5 ( 5`- 45548459 .. 45550628 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148100

Protein [Map View]
MTDNIFEGLPPPSSQHQELPDSSNPDESKDKSPSPAPTLVLKSSLKRSKPPESAPDASAPPVLKSALKRSKPAESTPEPE
PEAAPKKRLQFKTSTDASEEQVIEAMQKITSHIKNPSKFSKASKLAVRLIQAGSVKAETSSYLIAMLEAAMSSKTPCTDR
LVRADYHALFSAAQDVAECLDKSQKNLLTIWTIKAVVANDLFTDDSFMFSKTATQIKEAISDLPVATEEDDAEEAAALEQ
EAVKESGEGETTQDVASAGDQEDAESDPFGLDAWIPSHVKKNGKTKMTKEDTDALEDKKFLRSKREALITCLEIAARRYK
VPWCQTVIDILVKHAFENASRFTSQQRQAVEKLWASVREQHLRRKQGKSVTGKLDVTAFESLQDKYANEKMSIRRSVGAN
GERRAQQWLG*

DNA
ATGACGGATAATATCTTCGAAGGTCTACCTCCTCCGTCTTCTCAACATCAAGAGCTTCCCGATTCTTCAAATCCAGACGA
GTCGAAAGATAAAAGCCCCTCCCCAGCTCCGACTCTGGTTCTCAAAAGCTCCCTGAAGCGATCTAAACCACCAGAATCAG
CACCCGATGCCTCAGCTCCTCCTGTTCTCAAGAGCGCACTAAAGCGTTCAAAACCAGCAGAATCCACGCCTGAACCAGAA
CCTGAAGCAGCTCCTAAGAAGCGTCTGCAGTTCAAGACATCGACGGATGCATCAGAAGAGCAAGTGATCGAAGCGATGCA
GAAGATAACGTCTCACATCAAGAACCCTTCCAAATTCTCCAAAGCCTCGAAGCTCGCGGTACGCCTGATTCAAGCTGGAA
GCGTGAAGGCGGAAACTAGCAGTTACTTGATTGCGATGCTCGAAGCTGCTATGTCGTCGAAAACTCCTTGTACTGATCGC
TTGGTTAGAGCAGATTATCATGCTTTGTTCTCAGCAGCTCAAGATGTCGCCGAGTGCCTTGATAAAAGCCAGAAGAATCT
GTTGACCATATGGACGATTAAAGCAGTTGTGGCTAATGACCTCTTTACTGATGACAGCTTTATGTTTTCTAAGACTGCTA
CTCAAATAAAGGAGGCTATATCTGATCTTCCTGTTGCAACTGAGGAAGATGACGCGGAAGAAGCAGCTGCTCTTGAACAA
GAGGCTGTGAAAGAAAGTGGAGAAGGAGAGACAACACAGGACGTGGCTTCAGCTGGAGATCAAGAGGATGCCGAGTCAGA
TCCCTTTGGGCTGGATGCATGGATCCCCAGTCATGTGAAGAAAAATGGTAAAACAAAGATGACGAAAGAAGACACAGATG
CCTTGGAGGACAAGAAATTTCTCAGGTCGAAGAGAGAAGCTTTGATTACATGCCTGGAGATAGCTGCACGCCGTTACAAA
GTCCCATGGTGCCAGACTGTTATAGACATATTGGTGAAACACGCGTTTGAGAACGCGTCGAGGTTCACATCGCAGCAGAG
ACAAGCGGTGGAGAAACTGTGGGCTTCTGTTCGAGAACAGCATTTACGTAGGAAGCAAGGCAAGTCAGTGACGGGAAAAC
TCGACGTAACTGCTTTCGAAAGTCTTCAGGATAAATACGCCAACGAGAAGATGAGCATCCGGAGATCCGTTGGAGCCAAC
GGTGAACGCCGTGCACAGCAATGGCTTGGTTGA