Details for Kale Locus Bo5g148090

Position : C5 ( 5`- 45544922 .. 45545857 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148090

Protein [Map View]
MANPWWTGQVNLSGLETTPPSSSQLKKPDLHISMNMAMDSGHNNHHHHQEVDNSNEDDRDNLSGDEHEPREGAVEAPTRR
PRGRPAGSKNKPKPPIFVTRDSPNALKSHVMEIASGTDVIETLATFARRRQRGICILSGNGTVANVTLRQPSAATVPGPP
GGAAVLALQGRFEILSLTGSFLPGPAPPGSTGLTIYLAGGQGQIVGGSVVGPLMAAGPVMLIAATFSNATYERLPLDEEE
AAEGGGGGVVPGQLGGVGSPLSSGGGRGDGNQGLPVYNMPENLVSSGGGSGGGGQMSGQEAYGWAQARSGF*

DNA
ATGGCGAATCCATGGTGGACAGGACAAGTGAACCTCTCCGGCCTCGAAACGACGCCGCCTAGCTCATCCCAGTTAAAGAA
ACCAGATCTCCACATCTCCATGAACATGGCCATGGACTCAGGTCATAACAACCATCATCATCACCAAGAAGTCGACAACA
GCAACGAGGACGATAGAGACAACTTGAGCGGCGACGAACACGAGCCACGCGAAGGAGCCGTGGAAGCCCCCACACGCCGT
CCACGTGGACGTCCAGCTGGTTCCAAGAACAAGCCAAAGCCACCGATCTTCGTCACGCGCGATTCCCCAAACGCTCTCAA
GAGCCATGTCATGGAGATTGCTAGTGGGACTGACGTCATCGAAACCCTAGCTACTTTCGCTAGGCGGCGCCAGCGTGGCA
TATGCATCTTGAGCGGTAACGGCACGGTGGCTAACGTTACACTCCGACAACCTTCAGCAGCTACCGTTCCAGGGCCCCCT
GGTGGTGCGGCTGTTTTGGCGTTACAAGGGAGGTTTGAGATTCTTTCTTTAACCGGTTCTTTCTTGCCTGGACCGGCTCC
ACCTGGATCCACCGGTTTAACGATTTACTTAGCCGGTGGTCAAGGTCAGATTGTTGGAGGAAGCGTGGTGGGACCATTGA
TGGCAGCTGGTCCGGTGATGCTAATTGCTGCCACGTTTTCTAATGCGACTTACGAGAGATTGCCTTTGGATGAGGAAGAA
GCGGCTGAGGGAGGCGGCGGAGGAGTGGTTCCAGGGCAGCTTGGGGGCGTAGGTTCTCCTCTGAGTAGCGGTGGCGGTCG
AGGGGATGGAAACCAGGGACTTCCGGTGTACAATATGCCGGAAAATCTTGTTTCTAGTGGCGGTGGAAGCGGTGGAGGAG
GGCAGATGAGCGGTCAAGAAGCTTACGGTTGGGCTCAAGCTAGGTCAGGATTTTAA