Details for Kale Locus Bo5g148080

Position : C5 ( 5`- 45540752 .. 45541234 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148080

Protein [Map View]
MQLVLRFQTRPSVRRLMLAGKAPGLQHPNSNSILRGLIITLAYDDVNRTVTKRLLEKIGCEVTAVSSGFECLSALSNVEM
PYRVVILDLQMPEMDGFEVAMKIRKFYGYHWPLIIALTASTEDHVRERCLQIGVNGMIQKPVLLHVMDSELRRALQSASE
*

DNA
ATGCAACTAGTTCTTAGATTTCAAACAAGACCTTCCGTTAGAAGATTAATGCTAGCAGGAAAGGCTCCGGGGCTTCAACA
TCCTAATTCAAATTCTATTCTACGTGGTCTAATAATCACTCTAGCATATGATGATGTGAACAGAACCGTGACCAAGAGGC
TTTTAGAGAAAATTGGATGCGAAGTCACAGCTGTTTCGTCTGGTTTTGAGTGTTTGAGTGCTTTGTCAAACGTGGAAATG
CCGTATAGGGTTGTGATATTGGATCTGCAGATGCCTGAGATGGATGGTTTCGAAGTAGCGATGAAGATAAGGAAGTTTTA
TGGATATCACTGGCCATTGATTATAGCTTTGACTGCGAGTACTGAAGATCATGTTAGGGAAAGGTGTTTGCAAATAGGGG
TGAATGGTATGATTCAGAAACCTGTTCTTTTGCATGTTATGGATTCTGAGCTAAGACGGGCTTTACAGAGCGCAAGCGAG
TGA