Details for Kale Locus Bo5g148050

Position : C5 ( 5`- 45530088 .. 45533372 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148050

Protein [Map View]
MSDAEDQQNFVAHSGDEVPDHGLDEFHNGLEYQVHDETLGHHQPYEVQDPILEPHQYQPRDQEQYQLQHQAHGEAQDHDG
NDGGDQVDEGEEGVPEHVESLQKAEPEGDSTVGGEEKRWPGWPGETVFRMLVPPQKVGSIIGRKGDVIKKIVEETRARIK
ILDGPPGTTERAVMVSGKEEPESSLPPSMDGLLRVHMRIVDGLDGEASQAPPPTKVSTRLLVPASQAGSLIGKQGATVKA
IQEAAGCVVIVGSEDLPVFALQDDRAVEVVGEPTSVHKSLELIASHLRKFLVDRSIIPYFESQMQKPTRQMDHMSPPPSH
QYWGPPQGHAPSGGGGGPGYGHNPAPYMQQPPRHDSYYPPPMEKQPHQGISAYGRETPMNVHVSPAPPMASQQVTQKIQI
PLSYADAVIGTSGSNISYTRRLSGATVTIQETRGVPGEMTVEVSGTSSQVLAAMQLIQNFMAEAGAPAPAQPQAVVAPEQ
QGYNPYATHGSVYAAAAPTNPPGGYATDTV*

DNA
ATGTCTGATGCTGAGGATCAGCAAAATTTCGTTGCACACAGTGGAGACGAGGTTCCAGATCATGGGCTAGATGAGTTTCA
TAATGGGTTGGAGTACCAGGTCCATGATGAAACCCTTGGTCATCACCAACCATACGAGGTTCAAGACCCGATTCTTGAAC
CTCACCAGTATCAACCACGGGATCAGGAGCAGTATCAGTTGCAACACCAGGCTCATGGTGAGGCACAAGATCACGATGGA
AATGATGGGGGAGATCAAGTTGATGAAGGTGAGGAAGGAGTACCTGAGCATGTTGAGTCTCTGCAGAAAGCGGAACCTGA
AGGGGATTCAACAGTTGGAGGTGAGGAGAAGAGGTGGCCGGGATGGCCAGGAGAGACTGTGTTCCGCATGTTGGTTCCTC
CACAGAAGGTGGGTAGCATCATTGGTCGTAAAGGTGATGTTATTAAGAAAATAGTTGAGGAGACAAGGGCTCGTATCAAG
ATTCTTGATGGTCCTCCAGGCACAACCGAAAGAGCTGTTATGGTTTCTGGAAAAGAAGAGCCAGAATCATCTCTGCCTCC
TTCTATGGATGGCCTTCTGCGAGTCCACATGCGGATAGTTGATGGTCTGGATGGTGAAGCTTCTCAGGCCCCTCCGCCTA
CAAAGGTTTCAACAAGACTACTAGTTCCAGCATCTCAGGCTGGAAGTCTGATTGGAAAACAGGGAGCAACGGTTAAAGCC
ATTCAGGAAGCAGCTGGTTGTGTAGTTATAGTCGGATCAGAGGATTTGCCTGTTTTTGCTCTTCAAGACGATAGGGCTGT
TGAAGTTGTGGGGGAACCAACAAGTGTTCATAAATCCTTGGAGCTGATTGCATCACACCTCAGAAAGTTTTTGGTTGATC
GTAGCATCATCCCATACTTCGAAAGCCAGATGCAAAAGCCAACTCGCCAGATGGATCATATGTCGCCTCCGCCATCACAC
CAGTACTGGGGTCCACCTCAAGGCCATGCTCCAAGTGGTGGAGGAGGAGGTCCTGGCTATGGTCACAACCCAGCTCCATA
TATGCAACAACCTCCAAGACATGATAGTTACTATCCTCCTCCAATGGAGAAGCAACCTCATCAAGGTATATCTGCATATG
GAAGGGAGACTCCTATGAATGTGCATGTCTCACCGGCCCCACCTATGGCCTCTCAGCAAGTGACGCAGAAAATACAGATT
CCACTGTCTTACGCAGATGCCGTGATTGGGACATCAGGTTCAAACATAAGCTACACTCGTCGTCTTAGCGGAGCAACAGT
AACCATTCAAGAAACAAGAGGAGTACCTGGTGAAATGACTGTTGAGGTTAGCGGAACTAGTTCACAAGTCTTGGCCGCTA
TGCAGCTTATCCAGAACTTCATGGCTGAAGCTGGAGCACCGGCACCAGCACAGCCGCAAGCTGTAGTAGCACCAGAGCAG
CAAGGCTATAACCCCTACGCAACACATGGCTCAGTCTATGCAGCGGCGGCTCCGACGAACCCGCCTGGAGGATACGCTAC
GGATACAGTTTAG