Details for Kale Locus Bo5g147030

Position : C5 ( 5`- 45501602 .. 45501853 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g147030

Protein [Map View]
MSNLKGTNRVMVVAILIAACVFMNSNIAAGKFIGYPPISSGDRPPGCSPGTCPPPQPVNPYKPGCPIGSRCKRVPPQAPT
INI*

DNA
ATGAGCAATCTAAAAGGAACAAATAGGGTTATGGTTGTTGCAATACTCATAGCCGCATGTGTGTTTATGAACAGCAACAT
AGCGGCTGGAAAATTTATTGGATATCCACCAATAAGTAGTGGCGATCGGCCCCCTGGCTGTAGTCCTGGCACGTGTCCAC
CCCCACAACCAGTAAATCCCTACAAACCAGGATGTCCGATCGGGTCAAGATGTAAACGTGTCCCGCCACAAGCTCCAACA
ATCAATATCTAG