Details for Kale Locus Bo5g147020

Position : C5 ( 5`- 45489199 .. 45495966 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g147020

Protein [Map View]
MAELGQQTVDFSALVGRAAEESFLSLTELVEKAKSPELSDTDKKLSLLKYVVKTQQRMLRLNALAKWCKQVPLINSCQDL
GSSLSSHDICFTQAADSLFFMHEGLQQARAPVYDVPSAIEVLLTGSYQRLPKCVDDVGMQCSLDEQQQKPALRKLEVLVR
SKLLEITLPKEITEVKVSKGTVTLSVEGEFKVLVTLGYRGHLSMWRILLLDLLVGERSGGPIKLEVTRRHILGDDLERRM
SVAENPFTILYAVLHELCVAIVMDTVIRQVRTLLHGRWKDAIRFDLISDTGTAPANQEGEADSVSLKTPGVKLMYWLDYD
KNNAGSFVKIEPVSDLQIKCSHSTFVIDPLTGKEAEFSLDQSCIDVEKLLLKAICCNRYTRLLEIQKELLRSDRICRAPS
DVILQAFLDEPGSEGGNMIDSKQQIEPEVLRVRAYGSSFFTLGINIRTGKFLLQSSKSVLTPSILVEFEDALNQGSISAV
DAFINLRSKSILHFFAAIGKFLGLEVYEHGFGVNKAPKSLSDGSSILALGFPDCESSHLLLMELEKDFTPLFKLAETQTD
GSGKPQFLNDLSNVLRVKKIDIGQIRILEDDLNLITSDVARFVSSFSDAERSLNQASGHRGPGLVEESLAEMSGGQLSFS
SIVDEVFGHQKVTTSADGKAPLLTSYQSDSFYSMQVPLESSSFNLLSSPPPGKGSAMMKNPNKELSMVLSPSLTVVSESA
DLAVTSDGPLLRKDQKSRKRSASDLLRLIPSLQGVEGVTHPNKKSKTSASQALSTAVVTSTKAIGCSYGDLIAEANKGNA
PSSVFVYALLHVVRHSSLSIKHAKLTSQMEALDIQYVEEMGLRDSFSDIWFRLPFAQNDSWQHICLQLGRPGSMCWDVKI
NDQHFRDLWELQKGSKSTPWGSGVHIANSSDVDSHIRYDPEGVVLTYQSVEADSIKKLVADIQRLSNARRFSLGMRKLLG
IKADEKTEEPGGGNAAVKGPAGGKGGGEAVDRWRAFKIEAVGLTSLWFSFGSGILARFVVEWESGKDECTMHVSPDQHWP
HTKFLEDFINGGEVESLLDCIRLTAGPLTALAAATRPARASSATGVTVVPATATSRQSNQTQQTQPSTLAAPNAVGQSAS
GSAVASPSPAPSPLGGSFHGAAGRSGPGIVPSSLLPIDVSVVLRGPYWIRIIYRKRFAVDMRCFAGDQVWLQPATPPKGG
ASIGGSLPCPQFRPFIMEHVAQELNGLEPNLTGSQGATNPSGSRVNFSPSSAMSRAVMSRVGSVASGSLVVGSGLSVRRP
PGSGVPAHVRGELNTAIIGLGDDGGYGGGWVPLVALKKVLRGILKYLGVLWLFAQLPDLLREILGSILKENEGALLNLDQ
EQPALRFFVGGYVFAVSVHRVQLLLQVLSVRRFHHQQQQQNGSSGTAQEELTQSEIGEICDYFSRRVASEPYDASRVASF
ITLLTLPIPVLREFLKLIAWKKGLSQSQQAVEVAPAQRPRIELCLENHSGADVETSCAAKSNIHFDRPQSTVDFALTVVL
DPAHIPHINAAGGAAWLPYCVSVRLRYTFGDNPSVTFLGMEGSHGGRACWQRVDDWEKCKQRVSRTVEVNGSAAGDLTQG
KLKLVADSGQRTLHLCLQGLREGSSNNNTLQKEFTI*

DNA
ATGGCGGAATTAGGGCAACAGACGGTGGATTTCTCCGCCCTCGTTGGTCGAGCCGCGGAGGAGTCGTTCCTCTCCCTCAC
GGAGCTCGTTGAGAAGGCTAAGTCGCCGGAGCTTTCCGATACTGATAAGAAGCTCAGCCTCCTCAAGTATGTCGTCAAGA
CTCAGCAGCGGATGCTTCGGCTCAATGCCCTCGCCAAGTGGTGTAAACAGGTTCCTCTAATAAACTCCTGCCAAGACCTC
GGAAGCTCATTATCATCTCACGACATATGCTTCACACAAGCTGCGGATTCACTCTTCTTCATGCACGAAGGTCTCCAGCA
AGCTCGTGCTCCCGTCTACGACGTCCCCTCCGCTATTGAAGTCTTGCTGACAGGCTCTTACCAGCGCCTCCCAAAGTGCG
TAGACGATGTGGGGATGCAGTGCTCTTTGGACGAGCAGCAGCAGAAGCCAGCGCTAAGGAAGCTGGAGGTGCTCGTACGC
TCCAAGCTACTCGAGATCACGCTTCCAAAAGAGATCACAGAGGTGAAAGTCTCTAAAGGCACGGTTACCTTATCCGTGGA
GGGGGAGTTCAAGGTTCTGGTGACTCTCGGTTACCGAGGACACCTGTCCATGTGGAGGATACTGCTTCTGGATCTACTCG
TTGGTGAGAGAAGCGGTGGCCCGATTAAACTCGAGGTGACAAGACGGCATATCCTTGGCGATGATCTAGAGCGGAGAATG
TCAGTTGCGGAGAATCCATTCACTATATTATACGCGGTGCTCCATGAGCTTTGCGTCGCCATTGTCATGGACACGGTCAT
AAGGCAGGTCAGAACTCTTCTCCACGGGAGATGGAAAGATGCCATTCGGTTCGACTTGATCTCGGACACTGGCACAGCAC
CAGCAAACCAAGAAGGAGAGGCGGATTCTGTTAGTCTCAAAACGCCAGGAGTGAAGCTAATGTACTGGCTAGATTATGAT
AAAAACAATGCTGGCTCGTTCGTTAAAATCGAGCCGGTGTCAGATCTTCAGATTAAGTGTTCTCACAGCACGTTTGTGAT
TGATCCTCTGACCGGCAAGGAAGCTGAGTTTTCTCTGGATCAGAGCTGCATTGACGTGGAGAAGCTTCTGCTTAAAGCTA
TTTGCTGTAACAGATACACCCGTCTTCTTGAAATTCAGAAAGAGCTTCTGAGGAGTGACAGGATTTGTCGAGCTCCCAGT
GATGTCATTCTTCAGGCCTTCCTGGATGAGCCTGGCAGTGAGGGAGGTAACATGATAGACTCTAAGCAACAAATAGAGCC
AGAGGTATTACGTGTCCGAGCCTATGGATCATCATTTTTCACACTTGGGATCAATATAAGGACCGGTAAGTTTCTTCTTC
AGTCATCCAAGAGTGTCTTGACCCCCTCCATCTTGGTTGAATTTGAAGATGCGTTAAACCAAGGAAGCATATCTGCTGTT
GATGCCTTTATCAACCTGAGAAGCAAAAGCATTTTGCATTTTTTTGCCGCCATTGGCAAATTTTTGGGTCTTGAGGTCTA
CGAACATGGTTTTGGTGTAAACAAAGCCCCCAAAAGCCTCTCGGATGGGTCAAGCATTCTGGCGTTGGGGTTCCCTGACT
GCGAAAGCTCTCACCTCTTGCTCATGGAGCTCGAAAAGGACTTCACGCCGTTGTTTAAACTAGCGGAAACTCAAACGGAC
GGTTCGGGGAAGCCTCAGTTTCTCAACGATCTGAGCAACGTTCTGCGTGTTAAGAAGATTGATATTGGGCAGATACGGAT
TCTTGAAGATGATCTCAACTTGATCACATCGGATGTAGCTAGATTTGTGTCTTCGTTCTCAGATGCTGAGAGGAGCTTAA
ATCAAGCGTCTGGACACCGTGGTCCTGGACTAGTTGAGGAGTCTTTGGCGGAGATGAGTGGAGGGCAGTTGAGTTTCTCT
AGCATCGTTGATGAAGTGTTTGGACATCAGAAAGTGACGACATCCGCTGATGGAAAAGCTCCGTTGTTGACTAGCTATCA
ATCGGATTCCTTCTACAGTATGCAGGTCCCTTTAGAATCTAGCTCTTTTAATCTGTTGTCATCTCCTCCCCCTGGGAAGG
GTTCAGCTATGATGAAGAACCCTAACAAAGAGTTGTCCATGGTATTGTCTCCATCCCTAACTGTTGTCTCTGAGTCAGCT
GATCTTGCAGTTACCTCTGATGGTCCTTTGTTGAGAAAAGACCAGAAGTCACGGAAACGCTCAGCTTCAGATTTGCTAAG
ATTGATCCCATCTCTACAAGGAGTGGAAGGTGTAACTCATCCCAATAAGAAAAGTAAAACCTCTGCATCACAGGCCCTAT
CTACTGCAGTGGTAACATCAACAAAAGCTATTGGATGCAGCTATGGGGATCTCATAGCTGAAGCAAACAAAGGGAACGCA
CCTTCGAGCGTTTTCGTCTACGCTCTTCTCCACGTGGTCAGGCACTCTTCTCTGTCCATAAAGCACGCCAAGCTAACTAG
CCAGATGGAGGCGCTGGACATCCAATACGTTGAGGAGATGGGACTGAGAGATTCGTTTTCAGACATATGGTTCCGTCTTC
CGTTTGCTCAGAATGATTCCTGGCAACATATATGCTTGCAGCTCGGTAGACCTGGGAGCATGTGTTGGGATGTGAAAATA
AACGACCAGCACTTCAGGGATCTCTGGGAGCTTCAGAAGGGAAGCAAATCAACACCGTGGGGATCCGGAGTTCACATTGC
TAATTCGTCTGACGTTGATTCACATATCCGTTATGACCCTGAAGGCGTTGTTCTGACCTATCAGTCCGTGGAAGCAGATA
GTATCAAGAAGCTTGTGGCGGATATACAGAGGCTTTCGAATGCCAGAAGGTTCTCCCTTGGCATGCGGAAACTACTTGGC
ATAAAGGCGGATGAGAAAACAGAAGAGCCTGGTGGTGGTAATGCCGCTGTTAAAGGACCTGCTGGAGGGAAAGGCGGTGG
GGAGGCGGTTGATAGATGGAGGGCTTTCAAGATTGAGGCAGTGGGATTGACGAGCCTGTGGTTTAGCTTTGGTTCGGGCA
TTTTGGCTCGTTTTGTTGTGGAGTGGGAATCAGGTAAAGATGAATGCACCATGCACGTCTCTCCTGACCAACACTGGCCA
CATACCAAGTTCTTGGAGGATTTCATAAATGGTGGAGAGGTAGAATCTCTTCTGGATTGCATTCGCCTTACTGCTGGGCC
TTTGACTGCGTTAGCTGCCGCTACTCGCCCTGCCCGAGCTAGTTCAGCCACTGGCGTGACTGTCGTACCTGCTACAGCGA
CTTCCAGACAATCAAATCAGACGCAACAAACTCAACCTTCAACTTTAGCAGCTCCAAATGCTGTTGGCCAGTCTGCCTCA
GGGAGTGCTGTTGCTTCTCCTTCTCCTGCTCCAAGTCCACTCGGTGGAAGTTTCCATGGAGCTGCAGGGAGAAGCGGACC
TGGAATCGTTCCCAGCTCTCTCTTACCCATTGATGTCTCTGTAGTACTCCGTGGACCCTATTGGATAAGGATCATATACC
GCAAACGTTTTGCAGTGGACATGAGATGCTTTGCTGGAGATCAAGTCTGGTTGCAACCAGCAACACCACCCAAGGGCGGT
GCTTCTATTGGAGGCTCCTTGCCATGTCCCCAGTTCAGACCTTTCATCATGGAGCATGTTGCTCAAGAGTTAAACGGTTT
GGAACCGAATCTGACAGGTAGCCAAGGAGCAACAAATCCAAGTGGTAGCAGAGTTAACTTTTCCCCTTCTAGTGCAATGT
CAAGAGCCGTGATGAGTCGTGTAGGCAGCGTTGCTTCAGGATCTTTAGTGGTTGGCTCAGGGTTGTCTGTACGTAGACCA
CCAGGGAGCGGTGTGCCGGCACATGTAAGAGGCGAATTAAACACAGCGATTATCGGTTTAGGTGATGATGGTGGCTATGG
CGGAGGATGGGTTCCTCTTGTGGCTCTTAAAAAAGTTTTGCGTGGGATCCTCAAATACCTTGGAGTACTGTGGCTATTTG
CTCAGCTTCCAGATCTCTTGAGAGAGATCTTAGGTTCAATCTTGAAGGAGAACGAAGGCGCTCTCTTGAACTTAGACCAA
GAACAACCAGCGTTACGCTTCTTTGTCGGTGGCTATGTATTTGCGGTGAGTGTCCATAGAGTTCAGCTTCTTCTTCAAGT
CCTCAGCGTGAGGAGATTCCATCACCAGCAACAGCAGCAAAACGGTTCATCAGGTACTGCTCAAGAGGAGCTAACACAAT
CCGAGATTGGAGAAATCTGTGACTATTTCAGCCGCCGTGTTGCATCAGAGCCTTACGATGCTTCGAGAGTCGCCTCGTTC
ATAACACTCCTCACATTACCTATACCAGTCTTAAGAGAGTTTCTTAAACTGATAGCTTGGAAGAAAGGGTTATCACAATC
ACAACAAGCCGTAGAGGTTGCTCCTGCGCAGAGACCTAGGATCGAGCTATGCCTAGAGAATCATTCCGGTGCAGATGTTG
AAACTAGCTGTGCAGCTAAAAGCAATATCCATTTCGACCGGCCTCAGAGCACGGTTGACTTTGCTTTGACCGTGGTTCTT
GATCCTGCGCACATACCTCACATAAACGCAGCTGGAGGAGCGGCGTGGCTGCCTTACTGTGTATCGGTTAGGTTAAGGTA
CACCTTTGGGGATAACCCTAGCGTGACGTTTCTTGGGATGGAAGGAAGCCATGGAGGAAGGGCTTGCTGGCAGCGTGTTG
ATGATTGGGAGAAGTGTAAACAGAGAGTGAGCCGTACGGTGGAAGTCAACGGATCTGCTGCAGGAGATTTGACTCAAGGG
AAGCTCAAATTGGTTGCAGATAGTGGCCAGAGAACATTGCATCTATGTCTTCAAGGTCTCAGAGAAGGCAGTAGTAATAA
TAACACTCTTCAAAAGGAGTTTACCATATAG