Details for Kale Locus Bo5g147010

Position : C5 ( 5`- 45487109 .. 45489073 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g147010

Protein [Map View]
MFVRRGVRFFATECKRKTTTWDPLRSLELNHQSLVLLEKCNSRHQFKQILANIMRVNLIGDTFPMSRLILFSAITYPDNI
DLAKLLFRNFTPNPNVFVCNTMISSALSKKECFALYGSMIRHSVCPDRQTFLYLMKVTNFLSEVKQIHCHVTVSGVLSEG
NNYYLWNSLVKLYMELGGLGYAEKLFDEMPERDVSSFNTMIVGYAKKGYCLEAMKVYYKMVGDGIEADEYAVLGLLVCCG
RLSDVRLGKGVHGWIERRKPGSSSNLILWNAVLDMYFKCRESVFAKRVFDVMTKKDTCSWNTMVGGFVKLEDMEAARDVF
DQMPRRDLVSWNSLLLGYSKKGCDQRAVRELVYEMLIVENVVPDRVTFVSLISGAANNGELSQGRWAHGFMIRLGLQIDA
FLGSALVDMYCKCGSIERAFMVFKTVAEKDVTLWTTMITGTAFHGNGKQALQLFQEMQEEGVTPNKVTLLAVLTACSHSG
LVEEGLHIFNHMKETFGFDPETEHYGSLVDLLCRAGRLEEAKDIVQKKMPMRPSQSMWGSILSACRGGEDIETAEMALTE
LLKLEPDKEGGYVLLSNIYAAARRFGYSDKTREAMESRGVKKVAGYSSVVGVEGAHSFVATERQNHPRWLEIRGILHHLY
EEMSSNLDLIHSIL*

DNA
ATGTTCGTGCGTCGAGGAGTTCGGTTCTTTGCCACCGAATGTAAACGCAAGACGACAACATGGGACCCTCTTCGCTCCCT
CGAGCTCAATCACCAATCTCTTGTTCTGCTCGAGAAATGCAATTCGAGGCACCAATTCAAGCAGATCTTAGCGAACATCA
TGCGCGTCAACCTCATAGGCGACACGTTTCCCATGAGCCGTCTCATCTTGTTCTCAGCGATCACGTATCCAGACAACATC
GACTTGGCGAAGCTTCTGTTTCGTAACTTCACACCGAACCCAAACGTTTTCGTTTGCAACACAATGATCTCTTCTGCTCT
TTCGAAGAAGGAATGTTTTGCTCTGTACGGGTCTATGATTAGACACAGTGTTTGTCCCGACAGGCAGACGTTTCTGTACT
TGATGAAAGTAACGAACTTTCTGTCGGAAGTGAAGCAGATTCATTGTCATGTAACTGTTTCCGGGGTTTTGTCTGAAGGG
AATAATTACTACCTGTGGAACTCTCTGGTGAAGCTCTATATGGAGCTGGGGGGTTTGGGTTATGCGGAGAAGTTGTTCGA
TGAAATGCCTGAACGAGATGTTAGCTCTTTTAACACGATGATTGTTGGTTACGCCAAGAAGGGTTATTGTTTAGAGGCGA
TGAAGGTGTATTATAAGATGGTTGGTGATGGTATTGAGGCTGACGAGTACGCGGTGTTGGGTCTTTTAGTTTGTTGTGGT
AGATTGTCTGATGTTAGGCTTGGGAAAGGAGTTCATGGTTGGATTGAGAGGAGGAAGCCTGGCTCTTCCTCGAATTTGAT
ACTGTGGAATGCTGTTTTAGACATGTATTTCAAGTGCAGAGAGTCTGTTTTCGCGAAAAGAGTGTTTGATGTGATGACGA
AGAAGGATACGTGTTCTTGGAACACTATGGTTGGTGGCTTTGTTAAGCTTGAGGACATGGAAGCTGCTCGTGATGTTTTT
GATCAGATGCCTAGAAGAGATCTTGTGTCCTGGAACTCTCTGCTTCTTGGTTACTCTAAGAAGGGATGTGATCAGAGGGC
TGTGAGAGAGTTGGTCTATGAGATGTTGATAGTGGAGAACGTTGTTCCAGACAGAGTTACTTTTGTAAGTTTGATAAGTG
GTGCAGCAAACAACGGAGAGCTTAGCCAAGGAAGATGGGCACACGGGTTTATGATCCGTCTGGGATTGCAGATTGATGCC
TTTCTTGGTTCGGCTCTGGTGGATATGTACTGCAAATGTGGTAGCATCGAGAGGGCTTTCATGGTTTTCAAGACAGTTGC
TGAAAAAGACGTCACGCTATGGACGACAATGATAACTGGGACCGCCTTCCATGGAAACGGCAAGCAAGCTCTGCAACTAT
TCCAAGAAATGCAAGAAGAAGGCGTGACGCCTAACAAAGTCACTCTCCTCGCTGTTCTAACAGCTTGCAGCCATAGCGGC
CTAGTGGAGGAAGGGCTACACATTTTCAACCACATGAAGGAGACATTCGGGTTTGACCCTGAAACGGAGCACTACGGAAG
CCTTGTCGATCTCTTGTGCAGGGCGGGGAGATTAGAAGAAGCAAAAGACATAGTGCAAAAGAAGATGCCAATGAGACCAA
GCCAGTCGATGTGGGGATCAATCTTAAGCGCTTGCCGAGGAGGAGAAGATATCGAAACCGCAGAGATGGCTTTAACGGAA
TTGCTTAAGTTGGAGCCTGACAAAGAAGGTGGATACGTGCTGCTGTCCAACATCTATGCAGCCGCTAGAAGATTTGGATA
TTCAGACAAGACGAGAGAAGCAATGGAGAGCCGTGGAGTAAAGAAGGTTGCAGGATACAGTAGTGTAGTAGGAGTAGAGG
GAGCTCATAGCTTTGTGGCTACAGAGAGGCAGAACCATCCAAGATGGCTTGAGATTAGAGGAATATTGCATCATCTATAT
GAAGAAATGAGTTCAAACTTGGATCTTATTCATTCAATCTTGTAA