Details for Kale Locus Bo5g146990

Position : C5 ( 5`- 45475848 .. 45477076 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g146990

Protein [Map View]
MSAESASDIPKGQVDLLDFIDWSGVECLNQSSSHSLPNALKQGYREDAGLNLESDADEQLLIYIPFNQVVKLHSFAIKGP
EEEGPKTVKFFSNKEHMCFSNVNDFPPSDTAELTEENLKGKPVVLKYVKFQNVRSLTIFIEDNQSGSELTKVQKIALYGS
TVETTDMKGLKKIEDH*

DNA
ATGTCCGCCGAATCAGCCAGCGATATTCCTAAGGGACAGGTTGATCTGCTAGATTTCATTGACTGGTCAGGTGTTGAATG
CCTCAACCAAAGCTCAAGTCACTCCTTGCCCAATGCTCTCAAGCAGGGGTATAGAGAAGATGCGGGTTTGAACCTAGAGA
GTGATGCTGATGAACAGCTACTAATCTATATTCCTTTTAACCAAGTTGTCAAACTGCATTCTTTTGCTATCAAAGGCCCC
GAAGAGGAAGGTCCTAAAACGGTGAAGTTTTTCTCAAACAAAGAACACATGTGCTTCAGCAACGTCAATGATTTTCCTCC
GAGTGACACCGCTGAACTAACCGAAGAAAACCTCAAGGGAAAACCGGTGGTTCTTAAATATGTTAAGTTTCAGAATGTTC
GTAGCTTGACGATTTTCATTGAAGACAACCAATCGGGTTCTGAGCTCACAAAGGTTCAGAAGATCGCTCTTTACGGCTCA
ACGGTTGAGACTACTGATATGAAGGGGTTGAAGAAGATTGAAGATCACTGA