Details for Kale Locus Bo5g146980

Position : C5 ( 5`- 45474298 .. 45475125 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g146980

Protein [Map View]
MASLSFVSSSHLTLRAPSPNLRSSSPRPTSVSFSVKAQSVALSQDDLKKLAAEKAVESIKPGMVLGLGTGSTAAFAVDQI
GKLLSSGQLHDIVGIPTSKRTEDQARSLGIPLVALDTHPRIDLAIDGADEVDPNLDLVKGRGGALLREKMVEAVAERFIV
VADDTKLVKGLGGSGLAMPVEVVQFCWKFNLVRLKDLFREFGCEAKLRVGEGGEAYVTDNSNFIIDLYFKEPLKDGFAAG
REIGKFEGVVEHGLFLGMATSVIIAGKNGVEVMNK*

DNA
ATGGCTTCCTTATCCTTCGTCTCATCATCTCACCTCACTCTACGCGCTCCTTCTCCCAACCTACGCTCCTCCTCTCCCCG
TCCCACCTCCGTTTCATTCTCCGTCAAGGCCCAGTCCGTCGCACTCTCCCAAGACGACCTAAAGAAACTCGCCGCCGAAA
AAGCCGTCGAATCCATCAAACCGGGGATGGTCCTCGGCCTCGGAACCGGCTCCACCGCCGCCTTCGCCGTCGACCAAATC
GGAAAACTCCTCTCCTCCGGCCAGCTCCACGACATCGTCGGCATCCCGACGTCAAAACGCACCGAAGACCAAGCCCGATC
CCTAGGGATCCCCCTCGTGGCCCTCGACACGCACCCCAGAATCGACCTCGCGATCGACGGCGCCGACGAGGTGGATCCCA
ATCTGGACCTGGTCAAGGGGCGGGGCGGCGCGCTCCTGAGGGAGAAGATGGTGGAGGCCGTTGCCGAGAGATTTATCGTC
GTTGCGGATGATACGAAGCTCGTGAAGGGGCTAGGAGGGAGCGGGCTGGCGATGCCCGTCGAGGTTGTTCAGTTCTGTTG
GAAGTTTAATTTGGTGAGGCTGAAGGATTTGTTTAGGGAGTTTGGGTGCGAGGCGAAACTGAGGGTTGGTGAGGGTGGGG
AGGCGTATGTGACGGATAATAGTAATTTTATTATTGATTTGTATTTTAAGGAGCCGTTGAAGGATGGGTTTGCCGCGGGG
AGGGAGATTGGGAAGTTTGAGGGGGTGGTGGAGCATGGTTTGTTTCTTGGGATGGCTACTTCGGTGATTATCGCTGGGAA
GAATGGTGTTGAAGTTATGAACAAGTGA