Details for Kale Locus Bo5g146960

Position : C5 ( 5`- 45464492 .. 45467139 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g146960

Protein [Map View]
MVTKTEERELNQLENQVENGGGGIWEYLCLVRKLKVRRSEIVLKHGLSILNDSGKRFSLGPDEWTLYEQVAIAAMDCQSL
AVAQNCIKVLQKKFPESKRVGKLEALLIEAKGMWEEAEKAYSILLEDNPLDQVIHKRKVAMAKAQGKPSLAIEHLNKYLE
LFMADHDAWRELAEIYVSLQMYKQAAFCYEELILSQPTLPLYHLAYADVLYTIGGLENLIAARKYYAATIDLTGGKSTRA
LLGICLCGSAISQLSRGRNKEDKDMAAQELQSLAATALEKEYKQKSPAKLNLLSSALRSLKLS*

DNA
ATGGTGACGAAGACGGAGGAGAGAGAGCTAAACCAACTCGAGAATCAAGTCGAGAACGGAGGAGGAGGCATTTGGGAGTA
TCTCTGCCTCGTTCGCAAGCTCAAGGTTCGCCGATCAGAGATTGTGCTCAAGCACGGTCTCTCGATCTTGAACGATTCGG
GAAAGCGATTCTCTCTTGGTCCAGATGAATGGACACTATATGAGCAGGTAGCAATCGCAGCTATGGACTGCCAATCTCTT
GCTGTTGCACAAAATTGCATCAAGGTACTGCAGAAGAAATTTCCGGAGAGCAAACGTGTGGGAAAGCTGGAGGCGTTGCT
TATAGAAGCGAAGGGAATGTGGGAAGAGGCTGAAAAAGCCTATTCAATCCTTTTGGAGGATAATCCACTCGATCAAGTGA
TACACAAAAGAAAGGTGGCTATGGCCAAGGCACAGGGCAAACCTTCCCTAGCCATTGAACATCTTAACAAATATCTTGAA
TTATTTATGGCTGATCATGATGCCTGGAGAGAACTTGCAGAAATTTATGTTTCCTTGCAAATGTACAAACAAGCAGCTTT
CTGCTACGAGGAGCTCATTTTATCTCAGCCTACTCTTCCGTTGTACCACTTAGCATATGCAGATGTTCTCTATACGATTG
GTGGACTTGAAAACCTCATCGCAGCAAGAAAGTACTATGCAGCAACCATAGACTTAACAGGCGGTAAAAGCACGAGAGCC
CTCCTCGGAATATGCTTGTGCGGATCAGCGATCTCACAGCTCTCAAGAGGCAGGAACAAAGAGGACAAGGACATGGCTGC
ACAAGAGCTTCAGTCTCTGGCTGCAACTGCTTTGGAGAAAGAGTACAAGCAAAAATCTCCGGCCAAACTCAACCTCCTCT
CGTCTGCTTTAAGAAGCTTGAAACTTTCTTAA