Details for Kale Locus Bo5g146950

Position : C5 ( 5`- 45461378 .. 45462927 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g146950

Protein [Map View]
MAVGKNKRISKGRKGGKKKIVDPFSKKDWYDIKAPSNFNNRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHA
YRKIRLRAEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIESHVDVKTTDNYTLRLFCIAFTKRRANQVKRTCYAQSSQ
IRQIRSKMREIMIKEASSCDLKELVAKFIPEAIGKDIEKATQGIYPLQNVFIRKVKILKAPKFDLGKLMEVHGDYTAEDV
GVKVDRPADETAAEEPTEIIGA*

DNA
ATGGCCGTCGGGAAGAACAAACGAATCTCTAAAGGAAGAAAAGGAGGGAAGAAGAAGATTGTTGATCCTTTCTCCAAGAA
GGATTGGTATGACATCAAGGCTCCCTCTAACTTCAATAACAGAAATGTCGGAAAGACACTTGTTTCCAGAACTCAGGGTA
CCAAGATTGCATCAGAGGGTTTGAAACACAGAGTTTTCGAGGTTTCTCTTGCTGATCTCCAAGGTGATGAGGACCACGCT
TACAGGAAGATCCGTCTCAGAGCTGAAGATGTCCAGGGCAGGAATGTCTTGACCCAGTTCTGGGGTATGGACTTCACAAC
CGACAAGCTCAGGTCCTTGGTTAAAAAGTGGCAGACTCTGATCGAGTCCCATGTTGATGTCAAAACCACTGACAACTACA
CATTGAGGCTTTTCTGCATCGCCTTCACCAAGAGACGTGCTAACCAAGTCAAGAGAACTTGCTATGCTCAATCTAGCCAA
ATCCGTCAGATTCGCAGCAAGATGAGGGAGATTATGATCAAGGAAGCTTCCTCTTGTGACCTCAAGGAGCTTGTTGCCAA
GTTTATTCCCGAAGCTATTGGGAAGGATATTGAGAAGGCAACTCAGGGCATCTACCCTCTCCAGAATGTTTTCATCCGTA
AAGTCAAGATCCTCAAGGCTCCCAAATTCGACCTTGGAAAGCTCATGGAGGTTCACGGAGACTACACAGCAGAGGATGTT
GGTGTGAAGGTTGACAGGCCGGCCGATGAGACTGCTGCCGAGGAACCTACTGAGATCATTGGAGCTTAA