Details for Kale Locus Bo5g146940

Position : C5 ( 5`- 45458227 .. 45459075 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g146940

Protein [Map View]
MRDFPSCSGENGVQTADSPSSTAGKTAQNLVICIYRCRIRGKTCLITVTWTKSLMGQCVTVGVDGSRLCKVEIKPWLFTK
RKGSKNLCNISVFWDLSSAKFGSGPEPLGGFYVCVVADKEMTLLLGDMRREAFKKTNAAPSSSLGAVIIAKREHVFGKRT
FETKARFSNDGKTHDLVIDCDVSVSDPCLVVRVDGKVSMKVKRVHWKFRGNDTMVVDRVSVEVLWDVHSWFFGVPSSPGH
AVFMFRTCQQPVEKTWSLAQVPTSSKSQSVGFSLVLYAWKNE*

DNA
ATGAGAGATTTCCCTTCTTGCTCCGGCGAAAACGGCGTTCAGACTGCAGACTCTCCATCCTCCACCGCCGGCAAAACAGC
TCAGAATCTTGTCATTTGTATCTACCGTTGCCGCATCCGAGGCAAGACTTGCTTGATCACTGTCACATGGACCAAGTCTC
TGATGGGTCAATGCGTGACAGTAGGAGTCGACGGTTCTCGTCTCTGTAAAGTCGAGATTAAGCCCTGGCTCTTCACTAAA
CGAAAAGGCTCCAAGAATCTATGTAATATTAGTGTCTTCTGGGATCTCTCCTCTGCTAAATTCGGATCCGGCCCTGAGCC
TTTAGGAGGGTTCTACGTATGCGTGGTTGCGGATAAAGAGATGACTCTTCTCCTCGGTGATATGAGGAGAGAAGCTTTTA
AAAAAACTAACGCTGCACCGTCTTCATCTCTCGGTGCTGTGATTATTGCCAAGAGAGAGCATGTCTTTGGCAAGAGAACG
TTTGAAACAAAAGCTCGGTTTTCGAATGATGGCAAAACGCATGATCTTGTGATAGACTGTGACGTGAGTGTATCTGATCC
TTGTCTCGTTGTTCGTGTTGATGGGAAGGTCTCGATGAAGGTGAAGCGGGTTCACTGGAAGTTCCGTGGTAATGATACGA
TGGTTGTCGATAGGGTCTCTGTGGAAGTTCTTTGGGATGTTCATAGTTGGTTCTTTGGGGTGCCGTCATCGCCAGGCCAT
GCTGTGTTTATGTTCAGGACTTGTCAACAACCTGTTGAAAAGACTTGGTCGTTGGCGCAGGTTCCAACGAGCTCAAAATC
TCAGAGTGTTGGGTTCTCATTGGTTCTGTACGCTTGGAAGAACGAGTAG