Details for Kale Locus Bo5g146930

Position : C5 ( 5`- 45453934 .. 45456705 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g146930

Protein [Map View]
MASSIVFAATPATAFLSSVPPWKAPRRFHVRSSLDADVSDMSVNAPKGLFPPEPVPYKGPKLKVAIIGAGLAGMSTAVEL
LDQGHEVDIYDSRTFIGGKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLMKKVGADKNLLVKDHTHTFINKGSEIGELDFR
FPVGAPIHGIRAFLVTNQLKPYDKLRNSLALALSPVVKALVNPDGAMKDIRNLDSISFSDWFLSKGGTRASIQRMWDPVA
YALGFIDCDNMSARCMLTIFSLFATKTEASLLRMLKGSPNVYLSGPIKQYITDRGGRIHLRWGCREILYDKTSDGETYVT
GLAVSKATDKKVVKADVYVAACDVPGIKRLLPKEWRESRFFNDIYELEGVPVCTVQLRYNGWVTELQDIELSRQLKRAVG
LDNLLYTPDADFSCFADLALASPADYYIEGQGSLLQCVLTPGDPYMRLSNEKIIEKVAMQVTELFPSSRGLEITWSSVVK
IAQSLYREAPGKDPFRPDQKTPVKNFFLAGSYTKQDYIDSMEGATLSGRQASSYICDAGEELAELNKKLSSSTVSDELSL
V*

DNA
ATGGCTTCTTCGATCGTTTTCGCCGCAACTCCAGCTACTGCGTTCCTCTCCTCTGTTCCTCCGTGGAAGGCACCTCGGAG
GTTTCATGTTAGGTCTTCTCTCGACGCCGATGTTTCCGACATGAGTGTTAACGCTCCAAAGGGTCTGTTTCCTCCAGAGC
CTGTACCTTACAAGGGACCCAAGCTGAAAGTAGCTATCATTGGAGCTGGACTTGCTGGCATGTCAACTGCTGTTGAGCTT
CTCGATCAGGGTCACGAGGTGGATATATATGATTCAAGGACATTCATTGGTGGCAAAGTTGGTTCTTTTGTAGATAAACG
AGGGAACCACATCGAAATGGGACTACATGTGTTCTTCGGATGCTACAACAACCTCTTCCGCTTGATGAAAAAGGTGGGAG
CTGATAAGAATCTTCTTGTCAAAGACCACACTCATACGTTTATAAACAAAGGCAGCGAAATTGGAGAGCTTGATTTTCGG
TTTCCCGTTGGAGCTCCAATTCACGGTATCCGTGCGTTTCTAGTCACAAACCAACTCAAGCCCTATGACAAGCTGAGGAA
CTCGCTAGCTCTTGCATTAAGCCCGGTCGTTAAAGCTCTTGTTAACCCTGATGGAGCAATGAAAGACATTCGCAACCTGG
ACAGTATAAGTTTCTCTGATTGGTTCCTGTCGAAAGGTGGGACGAGGGCGAGTATCCAGAGAATGTGGGACCCTGTTGCT
TATGCACTCGGTTTCATAGACTGTGACAACATGAGTGCGAGATGCATGCTTACCATATTCTCCCTATTCGCCACAAAAAC
AGAAGCTTCTTTGTTGCGTATGCTCAAGGGCTCCCCTAATGTTTACTTGAGTGGTCCTATCAAACAATACATCACAGACA
GAGGCGGCAGAATCCATCTAAGGTGGGGTTGCAGGGAGATACTTTATGATAAAACATCAGATGGAGAAACTTATGTCACA
GGACTAGCAGTTTCCAAGGCTACAGACAAGAAGGTTGTGAAAGCTGATGTGTATGTTGCAGCATGTGATGTACCCGGAAT
CAAGAGGCTACTACCCAAAGAATGGCGGGAATCTCGTTTCTTCAACGATATATACGAACTAGAGGGAGTACCTGTTTGCA
CGGTGCAGCTCAGATACAATGGTTGGGTCACTGAGTTACAAGACATTGAACTTTCCAGGCAGTTGAAACGAGCGGTTGGT
TTAGATAACCTCCTCTACACTCCTGATGCTGATTTCTCATGCTTTGCGGATCTTGCGCTTGCTTCGCCTGCTGATTATTA
CATCGAAGGACAAGGCTCTCTGCTTCAATGCGTTTTAACGCCAGGAGATCCCTACATGAGATTATCGAATGAGAAGATCA
TAGAGAAAGTAGCAATGCAGGTCACAGAGCTGTTTCCATCGTCACGGGGTCTAGAAATCACCTGGTCATCAGTTGTCAAA
ATAGCTCAGTCGCTCTACCGTGAAGCACCAGGCAAAGATCCATTCAGACCTGATCAGAAGACTCCCGTAAAGAACTTCTT
CCTCGCCGGTTCATACACAAAGCAGGACTACATAGATAGTATGGAAGGAGCTACATTGTCAGGGAGACAAGCTTCGTCTT
ACATCTGTGACGCCGGTGAAGAGCTAGCTGAGCTAAACAAGAAGCTTTCTTCTTCTACAGTTTCTGATGAGCTAAGTCTT
GTCTAA