Details for Kale Locus Bo5g146920

Position : C5 ( 5`- 45452752 .. 45453423 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g146920

Protein [Map View]
MAGAASTSDLPLKIITGADAFGASLKDAMVSHLRSLGIAVEDTGVSSYYSAGSEVGRRVSSASSSSSEIRGLVCCGTGVG
VAMFANKFPGVYAATCLTVEDAVNARSISDCNVLALSGAKTSPETAVEIFDAWIGTPFKSPCPASGSEPWSSEISSFLDD
SLSEMAQIGKSTDHLSPVYID*

DNA
ATGGCGGGAGCTGCTTCCACCTCCGATCTACCGTTAAAAATCATAACCGGAGCTGATGCGTTCGGAGCAAGCCTCAAGGA
CGCGATGGTCTCCCACCTCCGCTCCCTCGGCATAGCCGTGGAGGATACCGGCGTGTCGTCATACTACTCCGCCGGATCCG
AAGTCGGCCGCCGCGTCTCCTCCGCATCATCTTCCTCCTCCGAAATCCGCGGCTTGGTATGCTGCGGCACCGGCGTCGGA
GTCGCGATGTTCGCCAACAAGTTCCCGGGAGTCTACGCCGCCACGTGTCTCACCGTCGAAGACGCCGTTAACGCTAGATC
GATCAGCGACTGCAACGTCCTCGCGCTCTCCGGCGCGAAAACCTCCCCGGAAACCGCCGTGGAGATCTTCGACGCGTGGA
TCGGAACTCCGTTCAAATCCCCGTGTCCTGCCTCCGGATCGGAGCCGTGGAGCTCCGAGATCTCCTCCTTCCTCGACGAT
TCCCTCTCCGAGATGGCTCAAATCGGAAAATCAACCGATCATCTTAGTCCGGTTTATATCGACTAA