Details for Kale Locus Bo5g146890

Position : C5 ( 5`- 45430035 .. 45431266 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g146890

Protein [Map View]
MAEKAVTIRTRKFMTNRLLSRKQFVIDVLHPGRANVSKAELKEKLARMYEVKDPNAIFVFKFRTHFGGGKSSGFGLIYDN
VESAKKFEPKYRLIRNGLDTKIEKSRKQIKERKNRAKKIRGVKKTKAGDPKKK*

DNA
ATGGCGGAGAAGGCAGTGACCATCCGAACCCGTAAATTCATGACCAACAGACTTCTCTCAAGGAAGCAGTTCGTTATTGA
TGTTCTTCACCCTGGAAGAGCCAATGTTTCAAAGGCTGAGCTGAAGGAGAAGCTAGCTAGGATGTACGAGGTCAAGGACC
CAAACGCCATCTTTGTTTTCAAATTCAGAACCCACTTTGGAGGTGGTAAATCTTCAGGCTTTGGTTTGATCTACGACAAT
GTCGAGAGCGCAAAGAAATTCGAACCCAAGTACAGACTTATCAGGAATGGTCTTGACACCAAGATCGAGAAATCAAGGAA
ACAAATTAAGGAAAGGAAGAACCGCGCCAAGAAGATCCGTGGTGTTAAGAAGACCAAGGCTGGTGATCCCAAGAAGAAGT
GA