Details for Kale Locus Bo5g146880

Position : C5 ( 5`- 45423897 .. 45429040 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g146880

Protein [Map View]
MTSDQRDVVFSLESPDLEEGAAGESDTDENDDVAIPETNEEPEEDDPEEEDLTTAVTVSASSTDAVTVALPAGSAVPVSV
IPVDSSDPKWHRVTEIVHHQRPPPPPQPQPPIDDSRRLFQRLWTDEDEIELLRGFLDYVATHRGGNSSHPPDTAPFYEMI
KSKLQLEFNKNQLVEKLRRLKKKYRNVMSKISSGKEVFFKSPHDQSTFEISRKIWNQTGKIIGFEDNNAMDFEETNTNGN
YFNSPGSNPTPSNVEIDSENGVEKRLMMMSSSSGGSRKRSRSRIGKIEEDNKPVITPSDVQTPNAASNVNLNEPATAVVG
GNIGVLIEETVKNCVSPVIKEMMNGTTSMMMAAMGGGGGNGHGFGSFSPVFTRPLGYGVEGGGGNKAVSDERWRKQQILE
LEVYSRRLELVQEQIRATLHELKTMPSGSLFVISSNQIWEVNLAGITRSLYSMEYSIKDDVTQLIGNTPMVYLNNIVDGC
VARIAAKLEMMQPCSSVKDRIAYGMIKDAEDKGLISPGKNILIEPTSGNTGIGIAMVGAARGYKVVITMPASVSIERRII
LLALGAELHLTDPSKGVIGVIVKAEEILSKTPDGFMPEQFRNPSNPQSHYDTTGPEIWRDSAEKVDMLVVGVGTGGTISG
AGKFLKEKNKDFKAYKLKFKISYMVIMDPMAAHENMGVYGVEPAESAVLSGGQPGPHGIQGIGAGLIPDNLDFSVLDEVI
QVTSVEAIETAKLLALKEGLLVGISSGAAAAAAIKVAKRPENAGKLIVVVFPSGGERYLSTPMFDSIRCEAENLAIE*

DNA
ATGACATCTGATCAACGCGACGTCGTTTTCTCCCTCGAATCACCGGATCTAGAAGAAGGAGCCGCGGGAGAGTCAGACAC
CGACGAGAACGATGACGTGGCGATCCCCGAAACAAACGAAGAGCCCGAAGAAGACGATCCCGAGGAGGAAGATCTAACGA
CCGCCGTAACCGTCTCCGCCTCCTCCACAGACGCCGTGACCGTCGCGCTCCCAGCCGGATCCGCCGTCCCCGTCTCCGTG
ATCCCCGTCGACTCCTCCGACCCGAAATGGCACCGCGTGACGGAGATCGTCCACCACCAGAGACCACCCCCGCCGCCGCA
GCCGCAGCCGCCGATCGACGACTCCCGGCGCCTCTTCCAGCGCCTCTGGACGGACGAGGACGAGATCGAGCTCCTCCGCG
GGTTCCTCGACTACGTGGCGACGCACAGAGGAGGGAACAGCTCGCACCCGCCCGACACGGCGCCGTTTTACGAGATGATC
AAGTCCAAGCTCCAGCTCGAGTTCAACAAGAACCAGCTCGTGGAGAAGCTGAGGAGGCTCAAGAAGAAGTACAGGAACGT
GATGAGCAAGATCAGCTCTGGAAAAGAAGTGTTCTTCAAGAGCCCTCACGATCAGTCCACGTTCGAGATCTCGAGGAAGA
TTTGGAATCAGACTGGGAAGATCATTGGGTTTGAGGATAACAATGCGATGGACTTCGAGGAGACTAATACCAACGGTAAC
TACTTTAACAGCCCTGGTTCGAATCCTACTCCTAGTAATGTTGAGATTGATTCTGAGAACGGAGTTGAGAAGAGGCTGAT
GATGATGAGTAGTAGTAGCGGAGGATCGAGGAAACGATCAAGATCGAGAATAGGGAAGATTGAGGAAGACAACAAACCGG
TCATCACTCCCTCTGATGTGCAAACACCAAACGCAGCTAGCAATGTGAACCTCAACGAGCCGGCGACAGCTGTTGTCGGA
GGAAACATTGGTGTTCTGATTGAGGAGACTGTGAAGAACTGCGTCTCTCCTGTGATCAAGGAGATGATGAACGGGACGAC
GAGTATGATGATGGCTGCAATGGGAGGAGGTGGTGGTAATGGTCATGGCTTTGGCTCGTTTAGTCCCGTGTTTACACGGC
CGTTAGGTTACGGCGTAGAAGGAGGAGGAGGGAACAAGGCCGTGAGTGATGAGCGGTGGAGGAAGCAGCAGATTCTGGAG
CTGGAAGTGTATTCGAGGAGATTAGAGCTGGTTCAAGAGCAGATTAGAGCTACATTGCATGAGTTAAAGACCATGCCGAG
TGGTAGTCTCTTTGTGATCTCCAGTAACCAAATCTGGGAAGTTAATCTTGCAGGAATTACAAGATCTTTATATAGCATGG
AGTACTCAATCAAGGATGACGTGACTCAATTGATAGGTAACACTCCAATGGTGTACCTAAACAACATTGTAGATGGCTGC
GTTGCACGTATCGCCGCTAAGCTTGAGATGATGCAGCCTTGCTCTAGTGTCAAGGACAGAATTGCTTATGGAATGATTAA
AGATGCAGAAGACAAGGGACTCATTTCTCCCGGCAAGAACATATTGATTGAGCCAACATCTGGTAACACCGGGATTGGTA
TAGCAATGGTCGGAGCAGCTAGAGGTTACAAAGTTGTGATTACAATGCCTGCATCAGTGAGCATTGAGAGAAGAATCATT
CTTCTAGCATTAGGTGCAGAGCTTCACCTCACGGATCCAAGCAAAGGCGTTATAGGAGTCATTGTCAAAGCTGAAGAGAT
ATTAAGCAAAACTCCAGATGGTTTCATGCCAGAGCAATTCAGAAACCCTTCAAACCCACAATCTCATTATGACACCACTG
GTCCAGAGATATGGAGAGACTCTGCAGAGAAAGTAGATATGTTGGTTGTTGGTGTTGGGACTGGTGGAACGATCTCTGGA
GCAGGGAAGTTTCTCAAGGAGAAGAATAAAGACTTTAAGGCTTATAAATTAAAATTCAAAATTTCTTATATGGTCATTAT
GGACCCCATGGCAGCCCATGAAAATATGGGTGTTTATGGGGTGGAACCTGCAGAGAGTGCTGTACTCAGTGGAGGGCAAC
CTGGTCCACATGGGATCCAAGGTATTGGAGCTGGACTCATCCCAGACAATTTGGATTTTAGCGTTCTTGATGAAGTCATT
CAAGTGACAAGTGTGGAAGCAATTGAAACAGCCAAACTTCTTGCCCTGAAAGAAGGATTATTGGTTGGAATATCATCCGG
AGCCGCTGCGGCCGCTGCTATAAAAGTGGCAAAACGGCCAGAAAACGCTGGGAAGCTCATAGTTGTGGTTTTCCCTAGTG
GCGGGGAACGTTACTTATCGACTCCAATGTTCGACTCCATCAGATGTGAAGCAGAGAATTTGGCAATTGAATGA