Details for Kale Locus Bo5g146850

Position : C5 ( 5`- 45372524 .. 45372917 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g146850

Protein [Map View]
MKISFSSVLFLLMIVFIISSSGNKKMVGEAKDCFQTWTCEGGRKCREKCTAKYKGIGRCDEITAPIVPPQCNCYYPC*

DNA
ATGAAGATCTCTTTCTCTTCTGTTCTCTTTTTACTTATGATTGTTTTCATCATTTCTTCTTCAGGTAACAAGAAAATGGT
AGGAGAAGCAAAAGACTGTTTTCAAACGTGGACGTGTGAAGGAGGAAGGAAATGCAGAGAAAAGTGCACAGCTAAATACA
AAGGGATTGGAAGGTGTGATGAGATCACTGCTCCTATAGTTCCTCCCCAATGTAATTGCTATTATCCTTGCTAA