Details for Kale Locus Bo5g146800

Position : C5 ( 5`- 45345117 .. 45346803 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g146800

Protein [Map View]
MVREVAESCVDTMLMEMVAMYSGRFYANKPELAARRIEAIGYQVGHQLSERYTMERPRFSDHLEAIKFICKDFWSEVFKK
QIDNLKTNHRGTFVLQDNKFRWLSRVSIDPSSEKETEDPSTPGESKAAQAVSMYLYFPCGIIRGVLSNLGIPCAVSADIS
SLPTCSFVIRVKA*

DNA
ATGGTGAGAGAAGTGGCGGAGAGCTGTGTAGACACCATGTTGATGGAGATGGTGGCGATGTACAGCGGCCGATTCTACGC
TAACAAGCCGGAACTCGCCGCTCGGAGGATCGAGGCCATCGGTTATCAAGTCGGCCACCAGCTCTCCGAGAGGTACACTA
TGGAAAGACCAAGGTTCAGCGACCATCTAGAGGCAATCAAGTTTATCTGTAAAGACTTCTGGTCTGAGGTCTTCAAGAAG
CAGATTGATAATCTCAAGACTAATCACCGGGGTACTTTTGTATTGCAAGACAACAAGTTCAGATGGCTATCTCGTGTCTC
GATCGACCCTTCGTCTGAGAAGGAAACCGAAGATCCGTCTACTCCAGGGGAAAGCAAAGCGGCACAAGCGGTGAGCATGT
ACCTGTATTTCCCATGTGGAATTATAAGAGGTGTCCTCTCCAACTTGGGGATACCTTGTGCTGTCTCTGCGGACATATCC
AGCCTTCCCACTTGCTCTTTCGTGATTCGGGTCAAGGCTTGA