Details for Kale Locus Bo5g146780

Position : C5 ( 5`- 45337143 .. 45337988 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g146780

Protein [Map View]
MSTTFCSSVSMQATSLAATTRISFQKPALVSRTNLSFNLSRSIPTRLSVSCAAKPETVEKVSKIVKKQLSLKDDQNVVAE
TKFADLGADSLDTVEIVMGLEEEFHIEMAEEKAQKITTVEEAAELIDELVQAKK*

DNA
ATGTCGACCACTTTCTGCTCTTCGGTCTCCATGCAAGCCACTTCTCTGGCAGCAACAACGAGGATTAGTTTCCAGAAGCC
AGCTTTGGTTTCAAGGACTAATCTCTCCTTCAATCTAAGCCGTTCAATCCCCACTCGCCTCTCAGTCTCCTGCGCTGCCA
AACCAGAGACGGTAGAGAAAGTGTCTAAGATAGTTAAGAAGCAACTCTCACTCAAAGACGATCAAAATGTCGTTGCGGAA
ACCAAATTTGCCGATCTTGGAGCAGATTCTCTCGACACTGTTGAGATAGTGATGGGTTTAGAGGAAGAATTTCATATCGA
AATGGCTGAAGAAAAAGCACAGAAGATCACAACGGTGGAGGAAGCTGCTGAGCTCATTGATGAGCTCGTGCAAGCCAAGA
AGTGA