Details for Kale Locus Bo5g146760

Position : C5 ( 5`- 45330816 .. 45333820 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g146760

Protein [Map View]
MTMLLASHFTSLTSKMLSVSTSDHASVVSLNLFVALLCACIVIGHLLEEHRWINESITALLIGLATGVVILLISRGKNSH
LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFVTIMAFGAIGTIISCTVISLGAIHFFKKLDIATFDLGDILAIGAIF
AATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVLFNAIQSFDLTHLNHEAAFHFLGNFLYLFLLSTVLGVATGLIS
AYVIKKLYFGRHSTDREVALMMLMAYLSYMLAELFALSGILTVFFCGIVMSHYTWHNVTESSRVTTKHTFATLSFLAETF
IFLYVGMDALDIEKWRFVSDSPGTSVAVSSILMGLVMLGRAAFVFPLSFLSNLSKKNQSEKIDIKQQVVIWWAGLMRGAV
SMALAYNKFTRSGHTELRGNAIMITSTITVCLFSTMVFGMLTKPLIRHLMPHQSTTTSMLSDDNTPKSMHMPLLDGEQQD
SFVEFSGSHHDVPRPDSLRGFLMRPARTVHHYWRQFDDAFMRPVFGGRGFVPFVPGSPIDRSTHDLSKP*

DNA
ATGACAATGCTGCTGGCTTCTCATTTCACCTCCTTAACATCTAAGATGCTGTCCGTGTCCACCTCTGATCACGCCTCTGT
TGTTTCGTTGAATCTCTTCGTTGCGCTTCTCTGCGCTTGTATTGTCATTGGCCATCTTCTGGAGGAGCATCGATGGATCA
ACGAGTCCATCACCGCTTTATTGATTGGGCTTGCCACTGGGGTCGTTATTTTGTTGATTAGTAGAGGGAAAAACTCACAT
CTATTGGTCTTCAGTGAAGATCTTTTCTTTATATATCTTCTCCCACCCATTATATTCAACGCAGGGTTCCAAGTTAAAAA
GAAGCAGTTTTTCCGCAATTTTGTGACTATTATGGCTTTTGGCGCCATTGGGACTATAATCTCTTGCACTGTAATATCTC
TAGGTGCAATTCATTTCTTTAAGAAACTAGACATTGCGACCTTTGACTTGGGAGATATCCTTGCAATCGGCGCCATATTT
GCTGCAACAGACTCTGTTTGCACGCTGCAGGTTCTCAATCAAGATGAGACGCCTTTGCTTTACAGTCTTGTATTCGGAGA
GGGCGTTGTGAATGATGCCACGTCAGTTGTGCTCTTCAATGCGATCCAGAGCTTTGACCTCACCCACCTTAACCATGAAG
CAGCTTTTCATTTTCTTGGAAACTTCTTGTATCTGTTTCTCTTGAGCACCGTGCTTGGTGTAGCAACTGGTCTGATAAGT
GCTTATGTCATCAAGAAGCTTTATTTTGGAAGGCACTCGACTGATCGAGAGGTTGCGCTCATGATGCTTATGGCTTATCT
TTCATACATGCTTGCTGAGCTATTCGCCTTGAGTGGTATCCTCACAGTATTTTTCTGTGGTATTGTGATGTCCCATTACA
CCTGGCATAACGTAACCGAGAGCTCAAGAGTAACTACCAAGCATACCTTTGCTACTTTGTCGTTTCTAGCCGAGACTTTT
ATTTTCCTTTACGTCGGTATGGATGCGTTGGACATCGAGAAGTGGAGATTCGTGAGTGACAGCCCGGGGACATCGGTTGC
AGTGAGCTCAATTCTGATGGGTTTAGTCATGCTTGGAAGAGCAGCTTTCGTGTTTCCTCTTTCCTTCTTATCAAACTTGT
CCAAGAAAAATCAGAGCGAGAAGATCGATATCAAGCAGCAAGTTGTGATTTGGTGGGCTGGTCTGATGAGAGGTGCTGTA
TCCATGGCTCTTGCCTACAATAAGTTTACAAGATCAGGACACACTGAATTGCGCGGGAACGCCATCATGATTACGAGTAC
TATAACCGTTTGTCTTTTCAGCACCATGGTGTTTGGTATGTTGACCAAACCGCTCATTAGACACCTGATGCCACATCAGA
GTACGACCACCAGCATGTTATCCGACGACAACACTCCGAAGTCTATGCACATGCCGCTCCTCGATGGCGAACAGCAAGAT
TCATTCGTGGAGTTCTCTGGGAGCCACCACGACGTGCCGCGACCAGACAGCCTTAGGGGCTTCCTGATGCGTCCGGCACG
CACTGTGCACCACTACTGGAGACAGTTTGATGATGCATTCATGCGTCCTGTCTTTGGTGGTCGCGGTTTTGTTCCTTTTG
TCCCTGGCTCTCCGATAGACAGAAGCACACATGATCTCAGTAAACCTTGA