Details for Kale Locus Bo5g146720

Position : C5 ( 5`- 45313864 .. 45316515 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g146720

Protein [Map View]
MGCVLSRPGSSGLVSESREEASTRIESNRKEANNVSVTTTESTSVAVVVSSTGEEVRNGEAIVEDHKEENGDVKEKKPKG
ERKKSTTKPDPRLSNPPKNLPGEQVAAGWPPWLTEVCGEALNGWLPRKADSFEKIEKIGSGTYSNVYKARDSLTGAIVAL
KKVRCETMEQENLKFMAREILILRRLNHPNVIKLEGLVTSRMSNSLYLVFRYMHHDLAGLAASPVITFTEQQVKCYMKQI
LSGLEHCHSRGVLHRDIKGSNLLIDDDGVLRIGDFGLATFFDASIRQKMTTRVVTLWYRAPELLHGAVEYGVGIDLWSAG
CILAELLSGRPIMPGRNEVDQIHRIYTLCGSPSEEYWRKIRLPSHVKHANHTAKPQHKRKVREEFKNFSPEALSLVDRLL
ALDPLERLTASDALTSDFFTTEPFACEPSELPKYPPTKEIDAKKRDEEYRRQREVRKVQGESGRRIRPRDRAPRAMPAPE
ANAENQSNIDRMRLITHANAKSKSEKFPPPHQDGSLGYQVGSSRRLDPSEIPFSSNSFTATYSKEPFQTWSGPLAPTEAH
DSTAKRMKDINKERRKAAKLKGKRIVV*

DNA
ATGGGTTGTGTATTGAGTAGACCCGGATCATCAGGATTAGTTTCCGAGTCTAGAGAGGAAGCTAGTACAAGGATCGAGTC
TAACCGCAAAGAAGCAAACAATGTGTCCGTGACTACTACAGAGAGCACTAGTGTTGCTGTTGTTGTTTCTTCAACTGGTG
AGGAGGTTAGGAATGGTGAAGCTATTGTGGAAGATCACAAGGAAGAGAACGGAGATGTCAAAGAGAAGAAGCCTAAAGGC
GAAAGAAAAAAGTCTACTACTAAGCCTGATCCGAGACTAAGCAACCCACCAAAGAACTTGCCAGGCGAGCAAGTTGCAGC
CGGGTGGCCACCGTGGCTGACTGAAGTCTGCGGTGAAGCTCTAAACGGGTGGCTTCCAAGAAAAGCTGATTCCTTTGAGA
AGATTGAGAAGATTGGATCAGGAACGTATAGTAATGTGTACAAAGCGAGAGACTCGTTGACTGGAGCCATCGTGGCGCTA
AAGAAAGTGCGGTGCGAGACTATGGAACAGGAGAACTTGAAGTTCATGGCTAGAGAGATTCTGATCCTGAGGAGGTTGAA
TCATCCCAATGTCATCAAGCTAGAAGGTTTGGTTACCTCCAGGATGTCAAATAGCTTATACTTGGTGTTCCGTTATATGC
ATCACGATCTAGCTGGTCTCGCCGCAAGCCCTGTCATAACATTCACCGAACAACAGGTTAAGTGCTATATGAAGCAAATA
CTCTCGGGGCTCGAGCACTGCCACAGCCGAGGAGTGCTTCACCGTGACATCAAAGGATCAAACCTTCTTATAGACGACGA
TGGAGTTCTGAGGATAGGAGATTTTGGTCTTGCGACGTTCTTTGATGCGAGTATAAGGCAAAAAATGACGACGAGGGTTG
TTACTCTATGGTACAGGGCACCTGAGCTGCTTCACGGTGCTGTTGAGTATGGTGTTGGTATTGATCTATGGAGCGCTGGT
TGCATTCTAGCAGAGTTGTTGTCTGGTAGACCGATTATGCCAGGTCGTAACGAGGTTGATCAGATACATAGGATATATAC
GTTATGTGGGTCGCCTTCTGAAGAGTATTGGAGAAAGATTAGGCTTCCTTCTCACGTTAAGCATGCTAATCACACGGCTA
AACCGCAGCATAAGAGGAAAGTAAGAGAGGAATTTAAAAATTTCTCTCCTGAGGCGCTTTCGTTAGTTGATAGGCTTCTA
GCTCTTGATCCGCTTGAGCGCCTGACAGCTTCAGATGCCTTGACGAGTGATTTCTTCACGACGGAGCCGTTTGCATGTGA
GCCCTCCGAGCTCCCCAAATATCCTCCAACTAAAGAGATTGATGCCAAGAAACGAGATGAAGAGTATAGGAGACAAAGGG
AAGTACGTAAGGTTCAAGGAGAGAGCGGAAGAAGAATCAGACCTAGAGACCGAGCACCTAGAGCAATGCCTGCTCCTGAA
GCCAATGCTGAGAATCAATCTAACATCGATAGGATGCGTTTGATCACACACGCTAATGCTAAGAGCAAGAGTGAGAAGTT
TCCTCCACCGCATCAAGACGGTTCACTTGGTTATCAAGTGGGATCTTCACGGCGTCTTGATCCATCAGAGATACCGTTTA
GCTCAAACTCGTTCACTGCAACTTACTCCAAAGAGCCGTTTCAGACTTGGTCAGGCCCTTTGGCTCCCACTGAGGCGCAT
GACTCAACAGCTAAGAGGATGAAAGATATTAACAAGGAGAGAAGAAAGGCTGCTAAACTTAAAGGGAAAAGAATCGTTGT
TTGA