Details for Kale Locus Bo5g146710

Position : C5 ( 5`- 45305879 .. 45309748 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g146710

Protein [Map View]
MHRVASSGSNGGSVRARKEKKLTYVLNDANDTQHCAGVNCLDVLKSSVSSDQSFLFTGSRDGTLKRWSFDEDAPLCSATF
ESHVDWVNDAALAGDSTLVSCSSDTTVKTWDSLSDGVCTRTLRQHSDYVICLAVAAQNCNVVASGGLGGEVFIWDIEAAL
SPVTKANDSMEDSSSNGANGIGSSQPVASLRNVGSSNNISVQSSPSHGYAPTVAKGHKESVYALAMNDTGTTLVSGGTEK
VLRVWDPRTGSKSMKLRGHTDNVRVLLLDSTGRFCLSGSSDSMIRLWDLGQQRCLHTYAVHTDSVWALACTSSFTHVYSG
GRDQSLYLTDLGTRESVLLCTKEHPIQQLALQDDSIWVATTDSSVERWPAEVQSPQKVFQRGGSFLAGNLSFNRARVSLE
GLNPPPAYKEPLVTIPGSHPIVQHEILNNKRQILTKDAAGSVKLWNITKGVVVEDFGKISFEEKKEELFEMVSIPSWFTV
DTRLGCLSVHLETPQCFSAEMYSADLKVSGRPEDDKINLSRETLKGLMGHWLAKKKHKPKPQASASGDILSAKDSKKNLT
ASKTEDSSAANDPVYPPFEFPSVSPPSIITEGSQGGPWRKKITEFTGTEDEKDFPLWCLDAVLNNRLPPRENTKLSFFLH
PCEGSNVQVVTLGKLSAPRILRVHKVTNYVVEKMVLDSPLDSLAIDGGPQPLFAGNGLLPSGSKPWQKLKPSIEILCNNQ
VLAPEMSLATVRVYIWKKPEDLILNYRVAIAR*

DNA
ATGCACCGGGTTGCAAGTTCCGGGAGTAATGGCGGTTCTGTCCGCGCTCGCAAAGAGAAGAAGCTTACTTATGTCTTAAA
CGATGCCAACGACACTCAGCACTGTGCTGGCGTTAATTGCTTGGATGTGTTGAAATCGTCTGTTTCCAGTGATCAGAGTT
TCCTTTTCACTGGAAGTCGTGACGGTACACTCAAGAGGTGGTCGTTTGATGAAGATGCGCCTCTTTGCTCTGCTACGTTC
GAGTCTCATGTTGATTGGGTGAATGACGCTGCTTTGGCTGGTGATAGCACTCTTGTTTCTTGTTCTTCAGACACTACGGT
CAAGACATGGGATAGCTTATCAGATGGAGTTTGTACGAGGACTCTCCGTCAGCACTCTGACTATGTTATTTGTTTGGCAG
TTGCGGCACAAAATTGCAATGTTGTTGCATCTGGTGGCCTTGGTGGGGAGGTTTTTATATGGGATATTGAAGCCGCTTTA
TCACCAGTTACGAAAGCTAATGATTCGATGGAAGATAGTTCCTCAAATGGTGCAAATGGTATTGGGAGCTCTCAGCCCGT
TGCAAGTTTAAGAAATGTTGGTTCCAGCAACAATATCTCTGTGCAGTCATCACCATCCCATGGGTACGCACCAACAGTTG
CCAAAGGCCATAAGGAGTCTGTCTATGCTTTGGCGATGAATGATACGGGGACGACGCTCGTCTCTGGTGGAACAGAGAAG
GTTTTACGTGTCTGGGACCCTAGAACTGGTTCAAAAAGTATGAAGCTGAGGGGGCATACAGATAATGTCAGAGTGCTGCT
TCTGGACTCGACTGGCAGGTTTTGCTTGTCTGGGTCCTCTGATTCTATGATAAGACTTTGGGATCTAGGTCAGCAGCGAT
GTCTTCATACCTATGCGGTGCATACAGATTCTGTTTGGGCGCTTGCATGCACTTCATCGTTTACTCATGTTTATAGCGGT
GGAAGAGACCAATCTTTATACTTGACAGACTTGGGAACAAGAGAGAGCGTTTTGCTGTGCACTAAGGAACATCCGATTCA
GCAACTAGCTTTGCAAGATGATAGTATATGGGTTGCAACAACAGACTCCTCTGTAGAGAGATGGCCCGCCGAAGTTCAGA
GTCCTCAAAAGGTCTTTCAGCGAGGTGGCTCTTTCTTGGCTGGGAACTTGTCTTTTAATAGGGCGAGAGTGTCATTGGAA
GGACTAAATCCTCCCCCTGCCTACAAGGAGCCGTTAGTGACTATTCCTGGAAGCCACCCGATTGTGCAGCATGAGATTCT
GAATAACAAAAGGCAAATTTTAACCAAGGACGCAGCTGGCTCAGTGAAGCTGTGGAATATAACTAAGGGTGTTGTGGTTG
AGGACTTCGGGAAGATATCATTTGAAGAGAAGAAAGAAGAACTATTTGAAATGGTAAGCATTCCATCATGGTTTACTGTG
GACACACGACTTGGGTGCTTATCCGTTCATCTTGAGACTCCACAATGCTTCTCTGCTGAGATGTATTCAGCTGACCTCAA
AGTTTCCGGGCGACCTGAAGATGATAAGATTAATCTATCCCGTGAAACACTGAAAGGCCTGATGGGTCATTGGCTAGCGA
AGAAGAAGCACAAACCAAAACCCCAAGCTTCTGCCTCTGGAGATATTCTATCCGCAAAAGACTCCAAAAAGAATCTGACT
GCATCCAAAACTGAAGACAGCAGTGCAGCGAATGATCCGGTGTATCCTCCCTTTGAGTTTCCTTCTGTCTCCCCTCCGTC
CATCATTACCGAGGGCTCTCAAGGAGGTCCATGGAGGAAGAAGATAACTGAGTTTACCGGAACTGAAGATGAGAAGGACT
TCCCCTTGTGGTGCCTTGATGCCGTCTTGAACAATCGCCTTCCTCCTAGAGAAAATACAAAATTAAGCTTCTTCCTGCAT
CCATGTGAAGGCTCAAATGTGCAGGTGGTCACACTAGGGAAACTTAGTGCACCTCGGATCTTAAGAGTTCACAAGGTTAC
CAATTACGTTGTGGAAAAGATGGTTCTTGACAGTCCGTTGGATAGTTTAGCTATCGATGGAGGACCACAGCCTCTGTTTG
CAGGAAATGGACTGCTACCGTCTGGATCAAAGCCTTGGCAGAAACTCAAACCTTCCATTGAGATCTTATGCAATAACCAG
GTCTTAGCTCCAGAGATGAGTTTGGCAACTGTGAGGGTATATATATGGAAGAAACCTGAGGATCTAATCCTCAACTACAG
GGTGGCTATAGCTAGATAA