Details for Kale Locus Bo5g146670

Position : C5 ( 5`- 45289791 .. 45291167 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g146670

Protein [Map View]
MAASDEVNLIDSKTVVPLNTWVLISTFKLSYNLLRRSDGTFNRHLAEYLDRKVTANANPEDGVFSFDVVIDRTTSLLSRV
YRPAYADQEGPVSVLDLEKPLDDEIVPVILFFHGGSFAHSSSNSKIYDTLCRRLVGACGGCVVVSVNYRRAPESPYPCAY
DDGWTALNWVNSRTWLESKKDSKVRVFLAGDSSGGNIVHNVALKAGEAGIDVLGNVLLNPMFGGEERTESEKRLDGKYFV
TVRDRDWYWKAFLPEGEDREHPACNPFGARAKSLRGLRFPKSLVVVAGLDLIQDWQLAYAEGLERAGKEVRLVHLEKATI
GFYLLPNNSYFHSVMDEIAAFVNAES*

DNA
ATGGCTGCGAGCGATGAAGTTAATCTTATTGATAGCAAGACAGTGGTTCCTCTCAACACATGGGTCTTAATCTCCACCTT
CAAACTATCCTACAACCTCCTCCGTCGATCAGACGGAACGTTCAACCGCCACTTAGCCGAGTACCTTGACCGTAAAGTCA
CCGCAAACGCCAACCCTGAAGACGGCGTGTTCTCATTCGACGTGGTGATAGACCGAACCACCAGCCTCCTAAGCAGAGTC
TACAGACCAGCTTACGCAGACCAAGAGGGACCTGTTAGTGTCCTAGACCTCGAGAAGCCCCTTGATGACGAGATAGTCCC
CGTGATACTGTTCTTCCACGGAGGCAGCTTCGCTCACTCCTCATCCAACAGCAAGATCTACGACACGCTCTGCCGCAGGC
TCGTCGGCGCGTGCGGCGGCTGCGTTGTCGTCTCTGTGAACTACCGCCGCGCGCCTGAAAGCCCTTACCCTTGCGCTTAC
GACGATGGCTGGACGGCTCTCAACTGGGTGAACTCGAGGACGTGGCTCGAGTCCAAGAAAGACTCGAAGGTTCGTGTCTT
TTTAGCGGGAGATAGCTCAGGTGGGAACATAGTCCACAACGTGGCGTTAAAGGCCGGTGAAGCGGGGATTGATGTGTTGG
GGAACGTTCTGCTTAACCCCATGTTCGGTGGGGAGGAGAGGACTGAGTCTGAGAAGCGTCTTGATGGGAAGTACTTTGTG
ACGGTTAGGGACCGTGATTGGTATTGGAAAGCGTTTTTGCCTGAAGGGGAGGATAGAGAGCATCCTGCTTGTAACCCGTT
TGGGGCGAGAGCGAAGAGCTTAAGAGGGTTGAGGTTTCCCAAGAGTCTTGTCGTTGTGGCGGGTTTGGATTTGATTCAGG
ATTGGCAGTTAGCTTACGCGGAAGGGCTCGAGAGAGCGGGGAAAGAGGTTAGGCTTGTGCATTTGGAGAAGGCTACTATT
GGGTTTTACCTCTTGCCTAATAATAGTTATTTTCACAGTGTTATGGATGAGATTGCTGCGTTTGTTAACGCGGAGAGTTG
A