Details for Kale Locus Bo5g146660

Position : C5 ( 5`- 45287295 .. 45288929 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g146660

Protein [Map View]
MAKKKGTRESNATFDDTPQSHDEKATKLSRQSSMEEDHHEKVQNLKSLNAMLVKQTVEKRQQIDSLANAKTELETELARY
GAERGEMRGELDQVRDENLGLRMELGLVMDYVGCRFREMGLGVERVARERDVIKNEFELQCGEVNKLKESVVVLVEERMV
REEERIEMEKAMEEKEEEIEGLKREKNEMEIVKSDQRGEIEELERKLGEVSDAVESLRKEEKALRGVVVRLEKNLDESVE
KERVMMVQIGVIGKEKMVKESELERLNKEKSSVEKQMVMVSVQCLDKAKLIDQLCREKVELEERVFSGEAKRVELSRKVD
ELERAVAALRKDCVDRTETNEKLQCKVGELRDALEQVEVEREEAGKALDEEKRHGEDLKADVSKSEMMIETTLVELEKVK
IEQESLSTAKNDLEKQSKSLKSVKAVLEKKLLELTKAIDALIESAGTDAKRSLVMLKRAASAVSHSDSEQQKQENGAESY
ALELESIEKAFKNKESIIEEMKKEAESMKQSTEEAHKKKSFWTVVSSVTTIFAAASFAYASRTR*

DNA
ATGGCCAAGAAGAAAGGGACGCGTGAGAGTAACGCCACGTTCGACGATACTCCACAAAGCCACGACGAGAAAGCTACTAA
ACTTAGCCGGCAGTCTTCCATGGAAGAAGACCACCACGAGAAGGTCCAGAACCTGAAGTCTCTCAACGCGATGCTCGTCA
AACAGACGGTTGAGAAGCGGCAGCAGATCGATTCGCTGGCAAATGCCAAGACCGAGCTGGAGACCGAGCTGGCTCGCTAC
GGCGCCGAGAGAGGCGAGATGCGTGGCGAGTTGGATCAGGTTAGGGACGAGAACCTGGGGCTGAGGATGGAGTTGGGGTT
GGTTATGGATTACGTCGGGTGTAGGTTTAGGGAGATGGGCCTTGGAGTGGAGAGGGTTGCGAGGGAGAGGGATGTGATCA
AGAACGAGTTTGAGTTGCAGTGTGGGGAGGTGAATAAATTGAAGGAGAGTGTGGTTGTGCTTGTGGAGGAGAGGATGGTG
AGAGAAGAGGAGAGGATTGAGATGGAGAAGGCTATGGAAGAGAAGGAGGAGGAGATTGAGGGGTTGAAGAGAGAAAAGAA
TGAGATGGAGATTGTAAAGAGTGATCAGAGAGGGGAAATCGAGGAGTTGGAGAGGAAGTTAGGCGAGGTGAGTGATGCTG
TGGAGAGTTTGAGGAAGGAAGAGAAGGCTTTGAGGGGTGTGGTTGTTAGGTTGGAGAAGAATCTTGATGAGTCCGTTGAG
AAAGAGAGGGTGATGATGGTGCAGATTGGTGTTATAGGGAAAGAGAAGATGGTTAAGGAGTCTGAGCTTGAGAGGTTGAA
TAAGGAGAAGAGTTCAGTTGAGAAGCAGATGGTGATGGTCAGTGTGCAGTGCTTGGATAAGGCAAAGTTGATTGACCAGT
TGTGTAGGGAGAAAGTTGAGCTCGAGGAGCGTGTTTTTAGTGGGGAGGCAAAGCGTGTTGAGTTGAGTCGTAAGGTTGAT
GAGCTAGAACGTGCCGTTGCTGCGCTGCGAAAGGATTGTGTTGATCGAACCGAGACGAATGAGAAGCTTCAGTGTAAAGT
TGGAGAGCTAAGGGATGCGCTTGAGCAGGTTGAGGTCGAGAGAGAGGAAGCTGGTAAGGCGCTTGATGAGGAGAAGAGAC
ACGGAGAGGATCTCAAGGCAGATGTTTCAAAGTCAGAGATGATGATTGAGACAACTCTAGTAGAGCTTGAGAAAGTTAAG
ATCGAGCAGGAGAGTTTATCTACAGCAAAGAATGATCTGGAGAAACAATCCAAATCACTGAAAAGCGTAAAAGCTGTACT
GGAAAAGAAGCTTCTAGAGCTCACAAAAGCTATCGATGCTCTGATAGAGTCCGCTGGAACGGATGCAAAACGCAGCTTGG
TGATGCTAAAGCGCGCCGCATCCGCTGTGTCGCACTCAGATAGCGAGCAGCAGAAGCAAGAAAACGGAGCGGAATCCTAT
GCCTTGGAGCTAGAATCAATAGAGAAAGCGTTCAAAAACAAAGAGAGCATAATCGAGGAGATGAAGAAAGAAGCCGAGTC
AATGAAGCAGTCAACAGAAGAGGCGCACAAGAAGAAGAGCTTCTGGACAGTTGTTTCCTCCGTAACAACGATTTTTGCTG
CTGCATCCTTTGCCTATGCCTCTAGGACTCGTTAA