Details for Kale Locus Bo5g146620

Position : C5 ( 5`- 45266698 .. 45270376 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g146620

Protein [Map View]
MEGENSIEKGLLLVNKEETSANTTPLLVFTTFIIVSASFTFGVALGYTAGTMSSIMEDLDLSIAQFSVFGSLLTFGGMIG
AIFSAKSADAFGRKMTLWLAEGFCISGWLAIALAKNVIWLDLGRFFVGIGVGLISYVIPVYIAEITPKNVRGTFTFSNQL
LQNCGLATVYYLGNFMAWRTIALIGIIPCLIQFFGLFFIPESPRWLAREGGDEECKVVLQKLRGKEANVMKETREIMICV
DATANVSMGSLFKKKYTRQLTIGVGLMLLQQLSGSAGISYYAGSIFELAGFPSRIGMTVLSMVVVPKAILGLILVERWGR
RPLLMVSALGLCLSCIFLALSFGLKGVPGFVNFTPTMAFIGVLTFNMMFAAGLGALPWIIMSEIFPMDMKAVAGSLVAIT
NWFTGWIVSYCFNFMLIWSQPGTFSIFAMISGLTILFAWCLVPETRGLSLEEIQLPHANILS*

DNA
ATGGAGGGAGAGAATAGTATTGAGAAAGGATTATTACTCGTAAATAAGGAAGAAACATCTGCAAATACAACTCCACTTCT
TGTTTTTACCACTTTCATTATTGTCTCTGCTTCCTTCACCTTTGGCGTTGCATTAGGTTATACTGCCGGTACAATGTCTT
CCATAATGGAAGATCTTGATCTTTCAATAGCACAATTTTCAGTATTTGGTTCGCTATTGACTTTTGGAGGAATGATCGGT
GCAATATTTAGCGCCAAAAGTGCAGATGCATTTGGCCGTAAGATGACTTTGTGGCTCGCCGAGGGATTCTGCATAAGTGG
ATGGCTTGCAATTGCACTAGCCAAGAATGTTATTTGGCTAGATCTGGGACGATTCTTTGTGGGAATTGGAGTTGGTCTCA
TTAGCTATGTGATTCCTGTATATATCGCAGAAATAACTCCCAAAAATGTGCGAGGCACTTTTACATTTAGCAATCAGTTG
TTGCAAAATTGTGGGCTGGCAACCGTATATTATCTTGGAAATTTCATGGCATGGAGAACGATAGCCCTTATCGGAATTAT
CCCATGCTTGATACAGTTCTTTGGATTGTTTTTCATCCCCGAGTCTCCAAGATGGCTGGCAAGAGAAGGTGGTGATGAAG
AATGTAAAGTTGTTCTTCAGAAGTTAAGAGGAAAAGAAGCTAATGTTATGAAGGAAACTCGTGAAATCATGATTTGTGTT
GATGCTACCGCAAATGTCAGCATGGGAAGTCTTTTCAAAAAGAAATATACTCGTCAACTTACGATCGGTGTGGGTTTAAT
GCTTCTGCAGCAATTATCTGGAAGTGCAGGAATATCTTATTACGCAGGCAGCATATTTGAGCTTGCCGGGTTTCCTTCGC
GGATTGGAATGACAGTGTTGTCAATGGTTGTGGTACCAAAAGCTATATTGGGTCTGATACTTGTGGAGCGATGGGGAAGA
CGACCACTTCTGATGGTATCAGCACTAGGGCTATGTTTAAGTTGTATCTTTCTTGCATTATCGTTTGGATTGAAAGGTGT
CCCTGGGTTTGTAAATTTTACACCCACCATGGCATTCATAGGAGTATTGACATTCAATATGATGTTCGCAGCTGGACTAG
GAGCACTACCATGGATTATAATGTCTGAGATATTTCCGATGGACATGAAAGCAGTAGCTGGGAGTTTAGTAGCCATCACG
AATTGGTTTACCGGTTGGATCGTCAGCTACTGCTTCAATTTTATGCTTATTTGGAGTCAACCAGGTACTTTTAGTATATT
CGCCATGATAAGTGGATTAACAATTTTATTCGCATGGTGTTTGGTGCCTGAAACTCGTGGACTATCCTTAGAAGAAATTC
AACTTCCTCATGCTAATATTCTGAGTTGA