Details for Kale Locus Bo5g146550

Position : C5 ( 5`- 45164524 .. 45166780 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g146550

Protein [Map View]
MNKQDVMKLQTCVLKVNVHCEGCKHKVRKQLQKIEGVYSVKADVEQGKVTVTGNVDPAILVKKLSKSGKHAEIIGGGGGG
GKGFPNLNGQFGNLSMNGKGGKESNQAKGKPNGGGGGVGGGHGGQPMQLTPQQIQQMMMMKAAQAQGGGGGGGGHGGKDM
KMMMPPVASKDQKKSVKFAEEEDDEFSDDDYDDEFSEDDYDDDEFDDEDEDDDMGGGHGHGGGGGGNHHMPPNKMMMMPN
KMMPQMGGGGGGAKGPNEMMMMMNGFKAGGGGGGGGEGKKGGGGFEIPVQMKGMGEGKMGKEGKKGGGDKGDKEGKKNKG
GGGKNGKTDAKSGGGGLLGFFKNGKSGKGDEKKGGGKKEGGGGGDKVKSSGGGGGGVHHYDSGPKKGGGGGSKGGGHGAH
DINELMKHHKAGGGGGGNKGNHSAKGMGGPMGQGGPMGMMGQGGPMGMMGHQGGQMGPMGHQGGSYPAVQGLPMSGGGGG
GYYPQPAQASHQMNQQQYMQMMMHQQQQQAAAAAHGGYGGGHGGDMYHPMMYARPYPSVNYAHPPPMPPPHSDSYTHMFS
DENPGSCSIM*

DNA
ATGAATAAACAAGATGTTATGAAGCTTCAGACATGTGTTCTGAAAGTGAACGTACACTGTGAAGGATGTAAGCATAAAGT
GAGGAAACAGTTGCAGAAAATCGAAGGAGTGTACTCTGTAAAAGCAGATGTGGAACAGGGGAAAGTCACTGTAACAGGAA
ACGTTGACCCAGCTATCCTCGTTAAGAAACTGAGCAAGTCAGGGAAACACGCCGAGATCATAGGCGGCGGAGGAGGCGGA
GGAAAAGGGTTTCCTAATCTGAATGGGCAGTTTGGTAATCTCAGTATGAACGGGAAAGGTGGGAAAGAGAGCAACCAAGC
TAAGGGGAAACCTAATGGTGGTGGTGGTGGTGTTGGTGGGGGACATGGAGGTCAACCAATGCAATTGACACCACAGCAGA
TTCAACAAATGATGATGATGAAGGCTGCTCAAGCTCAAGGTGGTGGTGGTGGTGGTGGTGGTCATGGCGGGAAGGATATG
AAGATGATGATGCCTCCTGTGGCGTCCAAGGATCAGAAGAAGTCTGTTAAGTTTGCTGAAGAGGAGGACGATGAGTTTAG
TGATGATGATTACGATGATGAGTTCAGTGAGGATGATTATGATGATGATGAGTTCGATGATGAGGATGAGGATGATGATA
TGGGAGGAGGACATGGTCATGGTGGGGGAGGAGGTGGTAATCATCACATGCCTCCTAACAAGATGATGATGATGCCTAAC
AAGATGATGCCTCAAATGGGTGGTGGTGGTGGTGGAGCTAAGGGACCTAATGAGATGATGATGATGATGAATGGTTTCAA
AGCCGGCGGTGGTGGTGGCGGCGGAGGAGAGGGGAAGAAAGGTGGTGGCGGGTTTGAGATTCCGGTGCAAATGAAGGGAA
TGGGTGAGGGTAAAATGGGGAAAGAAGGCAAGAAAGGAGGAGGAGATAAAGGTGATAAAGAAGGAAAAAAGAACAAAGGA
GGTGGGGGCAAAAATGGAAAAACAGATGCCAAAAGTGGTGGTGGTGGCCTGCTAGGGTTTTTCAAAAATGGTAAAAGTGG
TAAAGGAGATGAGAAGAAGGGAGGTGGTAAGAAAGAAGGAGGCGGTGGAGGTGATAAGGTCAAATCCTCCGGTGGTGGGG
GAGGAGGAGTTCATCATTATGACAGTGGGCCTAAAAAAGGTGGAGGTGGTGGGTCAAAAGGAGGAGGACATGGGGCCCAT
GATATTAATGAGCTCATGAAACACCACAAAGCAGGCGGAGGAGGAGGAGGTAACAAGGGTAATCATAGTGCTAAGGGGAT
GGGTGGACCAATGGGTCAAGGCGGTCCGATGGGTATGATGGGTCAAGGCGGTCCTATGGGCATGATGGGACACCAAGGTG
GTCAGATGGGTCCTATGGGACATCAAGGTGGCTCTTACCCGGCGGTTCAAGGCTTGCCGATGAGTGGAGGTGGAGGTGGA
GGATATTATCCACAACCAGCTCAGGCAAGTCATCAAATGAACCAACAACAATATATGCAAATGATGATGCATCAGCAACA
ACAACAAGCTGCAGCTGCAGCTCATGGAGGATATGGTGGTGGTCACGGTGGAGACATGTACCATCCAATGATGTATGCTC
GACCTTATCCGTCGGTGAACTATGCTCACCCACCGCCTATGCCGCCTCCACATTCGGATTCTTATACTCATATGTTCAGC
GATGAGAATCCAGGTAGCTGTAGTATAATGTGA