Details for Kale Locus Bo5g145520

Position : C5 ( 5`- 45131214 .. 45133792 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g145520

Protein [Map View]
MDRRSWLWRRKSSEKSPGETESTGSLSSHSERFSDDQRSHSPELISKPVTREEEKELEEEEEEEEEEATADIKILTERLS
AALLNVSLKDDLAKQHAKVAEEAVAGWEKAENEAAALKQQLDASLTKVSALEDRNTHLDSALKECVRQLWQGREEQNQKI
EEAINKKCTEWEAAKSELESRIQELQARLGTASVQEEDLYPKIEALEKENSALKQQLLSIAEEVKILTLERDLSTQAAES
ASKQHLEGIKKLTRLEVECRKLRVMVQRSVKSNELKSSTDNQSDYSGRFSFSDNEVQSPTQRSIGKTTMAPPVDIGLMDD
FLEMEKLASMPHSEPGRKHSESKPDAQSRQLKHELETSLQRISELEEKVEMVEVEKLQLEMALNESKEQVEALQSQLMET
EEKLSKLKKLEPRTQDLELSLDESKKQIHDLQRQLNKTQADKSKLETTRAENNDLELLLSESGSQIQDLQKQLNKAQVNL
SELETIRAEKLELTICLNGTKKQLETSQSRLKETERKLTEVQTLLRLTKDAKEAAEDGVKAANAKAEAVESRLRDVEAEA
ESLILKIGSLEKSIEKERVLSAKHISKCEELQDEISKLKHELEYHGEGEHEPNHVRAFDDDYKLKQEKELAVAASKFAEC
QRTIASLGQRLQSLATLEDFLIEP*

DNA
ATGGACCGGAGAAGCTGGTTATGGCGGAGAAAGTCATCTGAGAAAAGTCCTGGCGAGACAGAGAGTACAGGCTCACTCTC
TTCTCATTCTGAAAGATTCTCAGACGATCAGAGATCTCACTCACCGGAATTAATATCTAAACCTGTAACAAGAGAAGAAG
AAAAAGAACTAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAGGCAACGGCGGATATCAAGATTCTAACGGAGAGGCTCTCT
GCAGCTCTTTTAAACGTCAGTTTAAAAGACGACCTTGCCAAGCAGCATGCCAAAGTCGCAGAGGAAGCTGTCGCAGGTTG
GGAGAAGGCAGAGAACGAAGCTGCGGCTCTGAAGCAACAGCTTGATGCTTCTTTAACCAAGGTCTCTGCTCTTGAGGATC
GAAACACTCATCTCGATAGTGCACTCAAGGAATGTGTGAGGCAACTCTGGCAAGGAAGAGAAGAGCAAAACCAAAAGATT
GAAGAAGCTATAAACAAGAAATGCACAGAGTGGGAAGCTGCAAAGTCTGAACTTGAATCCCGAATCCAGGAGCTCCAAGC
CAGACTTGGAACTGCTTCAGTTCAGGAAGAAGACCTCTACCCGAAAATCGAGGCTCTAGAGAAAGAGAACTCAGCTCTGA
AGCAACAACTACTCTCAATAGCAGAAGAGGTTAAGATACTAACTCTTGAGAGGGACTTGAGCACTCAAGCAGCTGAATCC
GCCAGTAAACAGCACTTGGAAGGGATTAAAAAGTTGACTAGACTCGAAGTAGAATGCAGGAAACTGAGAGTCATGGTTCA
GAGATCTGTCAAGTCAAATGAGCTCAAGTCTTCTACAGATAACCAATCAGACTACTCAGGGAGATTCTCTTTTAGTGATA
ATGAAGTGCAGAGTCCTACTCAGAGGTCTATTGGGAAGACTACCATGGCTCCTCCAGTAGATATCGGTTTAATGGATGAT
TTTCTTGAGATGGAGAAGCTCGCTTCTATGCCGCATTCTGAACCTGGAAGAAAACATTCAGAGAGTAAACCTGATGCGCA
ATCAAGGCAGCTAAAACATGAACTTGAAACCTCACTTCAGAGAATTTCTGAGTTAGAGGAAAAAGTAGAAATGGTAGAGG
TGGAGAAACTGCAGTTGGAGATGGCTTTGAATGAATCCAAAGAGCAAGTGGAGGCACTGCAGAGTCAACTGATGGAGACT
GAGGAGAAGTTATCCAAGTTGAAGAAACTGGAACCAAGAACTCAAGATCTAGAGTTGTCATTGGATGAATCTAAGAAGCA
GATTCATGATCTTCAAAGACAGCTAAACAAAACACAAGCGGATAAGTCAAAACTAGAGACCACAAGAGCAGAAAACAATG
ATCTAGAGCTGTTGCTGAGTGAATCCGGGAGTCAAATTCAAGATCTCCAAAAGCAGCTAAATAAGGCACAGGTGAATCTG
TCAGAGCTAGAGACTATAAGAGCAGAGAAGCTGGAACTGACCATATGTTTAAACGGGACAAAGAAGCAGCTGGAGACATC
GCAAAGCCGGTTAAAGGAAACAGAGAGAAAGCTAACGGAGGTTCAGACTCTACTGCGTCTGACAAAGGATGCAAAAGAAG
CGGCTGAGGATGGTGTAAAAGCTGCAAACGCTAAAGCAGAAGCGGTTGAGTCCAGACTCAGAGATGTTGAAGCAGAAGCG
GAATCTTTGATCTTGAAGATCGGATCTTTGGAAAAGAGTATAGAGAAGGAACGTGTGTTATCAGCAAAACACATTTCAAA
GTGTGAAGAACTACAAGATGAGATCTCAAAGCTAAAACATGAACTTGAGTATCATGGAGAAGGAGAGCATGAGCCTAATC
ATGTGAGAGCTTTTGATGATGATTATAAGCTGAAACAGGAGAAGGAACTAGCAGTGGCTGCCTCAAAATTTGCAGAGTGC
CAGAGAACTATTGCTTCACTGGGTCAGAGATTACAGTCACTTGCTACACTTGAAGATTTCTTGATTGAACCTTGA