Details for Kale Locus Bo5g145510

Position : C5 ( 5`- 45128707 .. 45130182 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g145510

Protein [Map View]
MMTGGNYTTIDDSQKVSGSVPSVPDPGHTTVKFAESNLQTFPPSQGKISGGSNPLRDADDTFSGPGNGSTDEPHSGGWLH
KFTVGAYKPFFDVDTSDVMDRLKESLFPFRGTFTEKTADKPDLYGPFWICTTLIFVAASIGTFVTYVAHKWKKQEWNYDI
NLVTWSAGVFYGYVTIVPLALYVVLKYFSAPSGLVQLFCLYGYSLFIFIPALCLSVVPVEIFRWAIAGVAGFMSATFVAL
NLKAHINSAGERSILIIASIFLLQLGLAVVLKLYLFTVTV*

DNA
ATGATGACCGGCGGGAACTACACGACTATCGACGACAGCCAAAAAGTCTCTGGATCCGTACCTTCTGTTCCAGATCCAGG
TCACACCACCGTCAAATTCGCAGAATCAAATCTTCAAACCTTTCCTCCATCTCAGGGCAAGATCTCTGGTGGTAGTAATC
CTCTTCGTGATGCTGACGATACATTTTCTGGGCCTGGTAACGGTAGCACAGATGAACCTCACTCTGGTGGTTGGCTCCAT
AAGTTCACTGTTGGTGCGTACAAGCCCTTCTTTGATGTCGACACTTCGGATGTTATGGACAGACTCAAAGAATCTCTCTT
CCCATTCCGTGGAACTTTTACAGAGAAGACTGCCGATAAGCCTGACTTGTATGGTCCGTTCTGGATATGCACGACTTTGA
TATTCGTGGCAGCATCCATCGGCACATTTGTCACGTACGTAGCACACAAATGGAAGAAACAAGAATGGAACTACGATATC
AATCTGGTGACTTGGTCTGCAGGAGTGTTCTACGGCTATGTCACGATCGTTCCTCTCGCCTTATATGTCGTTCTCAAATA
CTTCTCTGCACCTTCAGGCCTAGTTCAGCTCTTCTGTCTCTACGGCTATTCCCTTTTCATCTTTATCCCTGCATTGTGTC
TCTCAGTCGTGCCAGTGGAGATCTTCAGATGGGCTATCGCAGGTGTAGCAGGGTTCATGTCTGCGACTTTTGTTGCTCTG
AACCTCAAAGCGCATATCAATTCCGCTGGGGAGAGATCGATCCTGATAATCGCAAGCATCTTTCTATTGCAGCTGGGGCT
TGCGGTTGTGCTGAAGCTCTATCTCTTCACTGTCACAGTATGA