Details for Kale Locus Bo5g145490

Position : C5 ( 5`- 45110567 .. 45112055 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g145490

Protein [Map View]
METSINSTTSSLFQWLGLIEDYDQPSTSTLPRVITLVALILGKMIQKNEKSLHTRHNKLCFGGRDHYVPWIKNTSMNIHR
YTERVYRYAHCSHACFVAAFAYILRYLERPVDTSMTCRLTSLNVHRLLITSLLVAAKFLDRKCYNNAYYAKIGGVSTEEM
NRLEKTFLFDLDFRLNITTEMFEKHCLVLQREAMPYDSSKLISVLGEVSWREGLVPFEKKKLGVKEEVYGKYSYLIQSAI
DYEVCLRADVFVGNSFSTFSSLIVLERTQKARRLGFVSTCEDGGNVWRSYAYNLAGESEGLPRRRMTNMTHSSLQAIS*

DNA
ATGGAAACTTCTATAAACTCCACCACCTCATCGCTCTTCCAATGGTTAGGTCTTATAGAAGATTATGATCAGCCTTCTAC
TTCTACCCTTCCTAGAGTCATCACCCTTGTCGCTTTAATTCTTGGGAAGATGATCCAAAAGAATGAAAAGTCACTCCACA
CAAGACACAACAAGTTATGTTTTGGAGGGAGAGATCACTATGTTCCATGGATCAAGAACACATCGATGAACATTCATCGC
TACACAGAGAGAGTCTATAGGTACGCTCACTGTAGCCATGCGTGCTTCGTTGCAGCATTTGCTTATATCCTGAGGTATCT
AGAAAGACCAGTGGATACAAGCATGACTTGTCGTCTCACATCACTCAACGTTCATCGCCTTCTCATTACCAGTCTCTTGG
TCGCAGCCAAATTCTTGGACCGCAAGTGTTATAACAATGCGTATTATGCAAAAATTGGCGGAGTGAGCACTGAAGAGATG
AATAGGCTGGAGAAAACGTTCTTGTTCGATCTTGACTTTAGACTAAATATTACAACAGAGATGTTTGAGAAACATTGTCT
CGTGTTGCAGAGAGAAGCGATGCCTTATGATTCAAGTAAACTTATATCAGTTCTTGGAGAGGTGTCTTGGAGAGAAGGGT
TAGTACCTTTTGAGAAGAAGAAGCTTGGGGTTAAAGAGGAGGTTTACGGCAAGTACTCGTATTTGATTCAGTCTGCTATT
GATTATGAGGTGTGTTTAAGAGCAGATGTTTTTGTTGGTAATAGCTTTTCTACTTTCTCTAGTCTCATTGTTCTTGAGAG
GACGCAGAAGGCGAGGAGGTTAGGGTTTGTGAGTACTTGTGAAGATGGTGGAAACGTGTGGAGATCTTATGCATATAATC
TGGCTGGAGAATCAGAGGGGCTTCCAAGGAGACGGATGACGAATATGACTCATTCGAGCTTGCAAGCTATTAGCTAG