Details for Kale Locus Bo5g145480

Position : C5 ( 5`- 45108099 .. 45110014 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g145480

Protein [Map View]
MVARTPQKQRKVAMVVAPPLNSELLRETINKVDKCMERLQELQYTIAGGTKVVSGVNLSPRSTRTYLKTSLRCKQETLRI
KNANNKKSPIGKFPASSPGDWRKMSLPAMLLGETVNEILQASQVTRDIVDALAPKKHRKSRRSIMPEEDEDGPKTPGTHQ
KSKEQNHETVSSNIKARRKKEKQNKRSEPTSPRARSRIVFKIVSPHKTAEKVQVKANRVSPKHKPWGKKAVLFPNPLFIS
GSSMQQAKFSRTMSPVIASSKDTKKETPHKFLIKSPSKSPSKFQVRIKSPPKVSVSPNRNGSNLARKSPLRSASLGKKSP
PKLSAAGKLRRSFTPTRNGSNVAGKSSVSPKRVTLQAFISPAKNCDLGKKSPSPTRVGNKTQKLSTAAKLRRSFSPSRLL
AMRLVSPMKSRKSVGRCDDDEKGMMLSGLRQRPVIVPKRFSMGRIS*

DNA
ATGGTTGCAAGAACCCCACAAAAGCAGAGGAAAGTGGCGATGGTGGTGGCGCCTCCTCTCAACTCAGAACTTCTCAGGGA
AACAATCAACAAGGTTGATAAATGTATGGAGAGACTGCAAGAGCTGCAATACACAATAGCAGGAGGAACCAAAGTTGTCT
CTGGTGTGAACCTTAGCCCTAGAAGCACTAGAACTTACTTGAAGACTAGTCTTAGATGCAAGCAAGAAACTTTAAGGATC
AAGAATGCTAATAACAAGAAATCTCCAATAGGAAAGTTTCCAGCTTCCTCACCAGGAGACTGGAGGAAAATGTCACTACC
AGCAATGCTACTAGGAGAGACTGTAAACGAAATCTTACAAGCCTCACAGGTGACCAGAGACATTGTAGACGCCCTTGCAC
CAAAGAAGCATAGAAAGTCCAGGAGATCAATAATGCCAGAAGAAGATGAAGATGGCCCTAAAACACCTGGGACCCATCAG
AAATCCAAAGAGCAGAACCATGAAACTGTCAGCAGCAATATCAAAGCGAGAAGGAAGAAAGAGAAGCAGAACAAACGGTC
AGAACCAACATCTCCTAGGGCTCGTTCAAGAATTGTGTTCAAGATTGTCTCTCCACATAAAACAGCAGAGAAGGTTCAAG
TAAAGGCTAATAGGGTTTCGCCAAAGCATAAACCTTGGGGGAAAAAGGCGGTTCTGTTTCCGAACCCTTTGTTTATTTCC
GGTTCCTCCATGCAACAAGCTAAGTTCAGTAGAACAATGTCTCCTGTCATAGCAAGCAGCAAGGACACTAAGAAAGAGAC
GCCACACAAGTTCTTGATCAAGTCTCCTTCCAAATCACCGTCGAAGTTTCAGGTCAGGATCAAGAGCCCGCCTAAAGTCT
CGGTTTCTCCCAACAGAAATGGAAGTAACTTGGCTCGCAAGTCTCCGTTAAGAAGCGCTTCCTTGGGAAAGAAGTCTCCA
CCAAAGCTATCAGCTGCTGGGAAGCTCAGAAGATCATTTACTCCAACGAGAAACGGAAGTAACGTGGCCGGCAAGTCATC
TGTTTCTCCCAAAAGAGTCACGCTTCAAGCTTTTATATCTCCGGCAAAAAACTGTGACTTAGGAAAGAAGTCACCTTCTC
CCACTAGGGTGGGAAACAAGACGCAGAAGCTATCAACTGCAGCAAAGCTGAGGAGGTCATTTTCACCATCAAGGCTACTA
GCAATGAGGCTGGTGTCTCCAATGAAGAGCAGGAAAAGTGTAGGGAGGTGTGATGATGATGAGAAGGGGATGATGTTGAG
TGGCTTGAGACAGCGTCCGGTTATAGTTCCTAAGAGATTCTCGATGGGGAGAATCTCATAA