Details for Kale Locus Bo5g145470

Position : C5 ( 5`- 45105522 .. 45107474 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g145470

Protein [Map View]
MNSRWVIQKLTSHIPSCLSTILCTSKLLTQQSPSCKVSTFLLNHVDISLLLSICGREGWFPHLGPSLHASVIKSPEFFEP
VDADIHRNALVVWNSLLALYVRNGELIDARKLFDEMPMRDNVSRNTVFNGFMKNREIQSGFVLLKRMLTPGGFDQATLTI
ALSVCDTPELCLVTKMIHGLAVLSGYDNVIPVGNSLITSYYKCGCSVSGRMVFDEMVQRNVITWTAVITGLVQNELHEDG
LRLFCLMRRGLVQPNSVTYLSALSACSGSQRVIEGKQVHALLWKVGIESELRVESMLMDMYSKCGSIEDAWNVFESAEET
DEVSMTVMLAGLAQNGSEEEAIHFFIRMLQDGVEIDANVVSAVLGVSFVDNSLGLGKQLHSLVIKRRFSGNTFVSNGLIN
MYSKCGDLDDSLSVFRRMSERNYVSWNSMIASFARHGHGLAALKLYEEMIRQDVKPTDVTFLSLLHACSHVKLINKGQEL
LKLMQDVYGIEPRTAHNACIVDMLGRAGRLEEAKSFIDSMPTKPDCLVWQALLGACSFYGDTQIGRYAAEQLFLSAPDSS
APHILMANIYSSRGQWKEREKTIKRMKAMGVTKETGVSWIEIENQTHRFVADDKLHPQGEAIHDVLSELFVVMIDEGYIH
DKRLLFCMNT*

DNA
ATGAATTCGAGATGGGTGATTCAGAAACTAACCTCTCACATTCCCTCTTGCCTCTCTACCATCTTATGCACTTCGAAACT
CCTAACCCAGCAGAGCCCAAGTTGCAAAGTCTCGACCTTTCTCCTCAACCACGTCGATATCAGCCTCCTCTTATCCATCT
GCGGCAGAGAAGGCTGGTTTCCTCACCTGGGTCCTTCCCTCCACGCCTCCGTTATCAAAAGCCCCGAGTTTTTCGAGCCC
GTTGATGCTGACATCCATCGAAACGCTCTCGTTGTTTGGAACTCTCTGCTCGCACTGTACGTTAGAAACGGAGAGTTAAT
TGATGCGCGCAAGTTGTTCGACGAAATGCCCATGAGAGATAATGTTTCTCGGAACACGGTGTTTAATGGGTTTATGAAGA
ACAGAGAGATACAGTCTGGTTTTGTGTTGCTTAAGAGAATGCTTACACCCGGTGGGTTTGATCAAGCGACCTTGACGATT
GCTTTATCGGTTTGCGATACTCCAGAGCTCTGTTTGGTGACCAAGATGATCCACGGTTTAGCTGTTTTAAGCGGTTATGA
CAATGTAATCCCCGTGGGGAACAGTTTGATCACGTCTTATTACAAATGTGGGTGTTCTGTTTCTGGGAGAATGGTTTTTG
ATGAGATGGTGCAAAGAAATGTTATAACTTGGACGGCTGTGATTACTGGTTTGGTGCAGAATGAGTTACATGAAGATGGT
TTAAGATTGTTTTGTTTGATGCGTAGAGGATTGGTTCAACCGAACTCAGTAACTTATCTGAGCGCTCTATCTGCTTGTTC
AGGCTCACAGAGGGTAATAGAAGGGAAACAGGTTCATGCTCTTCTGTGGAAAGTTGGGATTGAATCAGAGCTACGCGTTG
AGAGTATGCTAATGGATATGTACTCCAAATGCGGAAGCATTGAAGACGCCTGGAATGTTTTTGAGTCCGCTGAAGAAACT
GATGAAGTTTCGATGACTGTGATGTTAGCTGGTTTAGCACAAAACGGGTCAGAGGAAGAAGCTATACATTTCTTCATCAG
AATGCTGCAAGATGGTGTGGAGATAGATGCAAATGTGGTTTCAGCAGTTCTTGGAGTCTCGTTTGTGGATAACTCTTTGG
GTCTAGGCAAGCAGCTTCATTCGTTGGTTATCAAACGAAGATTCTCCGGTAACACCTTTGTTAGCAACGGACTCATCAAC
ATGTACTCAAAATGCGGAGATCTGGATGATTCACTCAGCGTGTTTAGAAGAATGTCAGAAAGGAACTACGTTTCATGGAA
CTCAATGATTGCATCGTTTGCACGCCATGGTCACGGATTAGCTGCCTTGAAGCTATACGAAGAAATGATTAGGCAAGACG
TGAAGCCAACAGATGTTACCTTTTTGTCACTGCTCCATGCTTGTAGCCATGTAAAGCTGATCAACAAAGGCCAAGAACTC
TTGAAACTGATGCAAGATGTCTACGGAATCGAGCCTAGGACAGCGCATAACGCCTGCATCGTTGACATGTTGGGGCGAGC
TGGTCGTCTAGAAGAAGCAAAGAGTTTTATAGACTCAATGCCTACGAAACCTGACTGCCTGGTTTGGCAGGCGTTGCTTG
GTGCTTGTAGTTTCTACGGTGACACTCAAATAGGGAGATATGCAGCTGAGCAGTTGTTTCTCTCTGCACCTGATAGCTCA
GCTCCTCATATTCTGATGGCTAACATATACTCATCGAGAGGACAGTGGAAGGAGAGAGAGAAGACGATCAAGAGAATGAA
AGCAATGGGAGTGACTAAAGAAACAGGAGTAAGTTGGATTGAAATCGAGAATCAAACACATAGATTTGTTGCTGACGACA
AGTTGCATCCACAAGGAGAGGCTATACATGATGTTCTCTCTGAATTGTTTGTTGTTATGATAGATGAAGGTTACATACAT
GATAAGAGGTTACTCTTCTGCATGAATACATAA