Details for Kale Locus Bo5g145450

Position : C5 ( 5`- 45094178 .. 45099014 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g145450

Protein [Map View]
MAPAVRKSRSVNKRFTNEPSPRKDAGSSRKSKQRKTKFSDKLGPQWTKGELERFYDYYRKYGQDWRKVAAAIRNSRSVDM
VEALFNMNKAYLSLPEGTASVAGLIAMMTDHYSVMEGSGSEGEGLDVPEAPRKQQKRKRAKPQLSDSREEDDRQQHPVAS
TDGCLKFLKQARANGTHRRATGKRTPRVPVQTSRDDGEGATPPNKRARKQRLDANDDVAAHFLELTLTDASRWEGSPQVS
ESPNKRTEPSDKSPIKSWGKMSRTRKASREKKLESDREDVEGVGEMEAPRKVKRVYKKRVNVEEAECNDSDDNGGACSAT
EGRRIKSKRRKAGVEASRGTYSPRSPKEEDNKFTSGDEFDALQALADLSASLLPGALMESESSAQLKEERIENDMDEKSS
SPDDSHGEKADSEPDDSLLHAISAIGNAAYSRKPKSSRQPSTDCNAVPTEKLEPEPISGSSRRKRKPKKLWDETPAESTR
KKSTNKQKELAQEDVNMKSSPRTKRSGQGPPQSKQLNAVKELEESTTTTSDKKRSAMDVVEVATTKEVSDSGAASIPQKP
PNRRKMSLKKSLQERDNKSSETIHKASRSSRSLSEQELLLKDKLSTSLSHPLARRRCMFEWFYSAIDHPWFAKMEFVDYL
NHVGLGHIPRLTRLEWSVIKSSLGRPRRFSERFLQEEREKLKQYRESVRKHYTELRTGAREGLPTDLARPLAVGNRVIAI
HPKTREIHDGKILTVDHSQCNVLFDDLGVELVKDIDCMPSNPLEYMPEGLRRQVDKCLSIKKEAQLSGVSVIFPPCGLEN
VDFSMNQSLNQGDMVAPILHGKVLASPHQTSQPCIINYSKGREAEIQRVLALQHALDEKEMEPEMIEIVKGSKTRAQAMV
DAAIKAASSVKEGEDAIKMIQEALDMVGKHQPLRSSVVKHEEHANGGVGHHQNPSPSSDASKPVANNDFISQDGSEKNEA
QMPSELVTSCVASWLMIQMCTERQYPPSDVAQLIDTAVTSLQPRCPQNLPIYREIQMCMGRIKTQILSLVPS*

DNA
ATGGCACCGGCGGTTAGGAAGTCGAGGAGTGTGAACAAGCGTTTCACCAATGAACCTTCGCCGAGAAAAGATGCTGGGAG
CTCCAGAAAATCTAAGCAGCGTAAGACGAAATTTTCTGACAAGCTGGGACCTCAGTGGACCAAAGGAGAGCTCGAGCGTT
TCTATGACTACTACCGAAAGTACGGGCAGGACTGGAGAAAGGTGGCTGCTGCAATTCGGAATAGCAGGTCTGTTGACATG
GTGGAAGCCCTTTTTAACATGAATAAGGCTTATTTATCTCTTCCGGAAGGAACTGCCTCTGTAGCTGGTCTCATTGCTAT
GATGACCGATCATTACAGCGTCATGGAAGGGAGTGGCAGTGAAGGAGAGGGCCTTGATGTTCCAGAAGCACCGAGGAAAC
AGCAAAAGCGCAAACGTGCAAAACCTCAGCTTAGTGATTCTCGAGAGGAAGATGATAGACAACAACATCCCGTTGCGTCA
ACTGATGGATGTCTCAAGTTTTTGAAACAAGCACGAGCTAATGGAACTCATCGACGTGCCACTGGCAAACGCACACCTCG
GGTTCCTGTACAGACTTCACGGGATGATGGGGAAGGCGCTACTCCACCAAATAAAAGAGCCAGAAAGCAACGACTTGATG
CTAATGATGATGTTGCTGCACATTTTTTAGAATTGACATTAACAGACGCATCCAGATGGGAAGGGTCTCCACAAGTTTCT
GAATCACCAAATAAAAGAACAGAACCTAGCGACAAGTCGCCAATAAAGAGCTGGGGGAAAATGTCGCGAACGAGAAAAGC
TAGCCGAGAAAAGAAGCTTGAATCTGATAGAGAGGATGTGGAAGGAGTTGGCGAAATGGAGGCTCCACGGAAGGTTAAAA
GGGTCTACAAGAAAAGAGTCAATGTCGAAGAAGCAGAGTGTAATGATTCTGATGACAACGGTGGGGCATGCAGCGCCACT
GAGGGGAGGAGGATTAAATCAAAGAGACGCAAGGCAGGTGTTGAAGCCTCAAGAGGGACATATTCACCGCGCAGCCCAAA
AGAAGAAGACAACAAATTTACTTCCGGAGATGAATTTGATGCTCTGCAAGCCTTAGCTGATTTGTCAGCTTCATTGCTTC
CGGGAGCTTTGATGGAATCAGAATCTTCTGCTCAGTTGAAGGAAGAGAGAATAGAAAACGACATGGACGAGAAATCTAGC
TCACCAGATGATAGTCATGGGGAAAAAGCAGATTCAGAACCAGATGATAGTCTCCTTCATGCCATTTCTGCTATTGGGAA
TGCTGCTTACAGTAGAAAACCAAAATCTTCAAGGCAACCATCCACTGATTGTAACGCTGTTCCCACGGAGAAGCTTGAAC
CGGAGCCTATTAGTGGCAGTTCAAGAAGAAAAAGGAAACCAAAGAAGCTATGGGATGAAACTCCAGCTGAATCTACTCGG
AAGAAATCCACAAACAAGCAGAAGGAATTGGCTCAAGAAGACGTTAATATGAAGTCTTCGCCTAGAACAAAACGTTCTGG
TCAAGGCCCCCCTCAGTCAAAACAGTTGAACGCTGTCAAGGAGTTGGAGGAATCTACTACAACAACGAGCGATAAGAAAA
GATCTGCGATGGATGTAGTAGAAGTGGCAACAACTAAAGAAGTTTCTGATTCGGGTGCAGCCAGTATACCGCAGAAGCCA
CCAAACAGGCGTAAGATGAGTCTGAAGAAAAGCTTACAGGAAAGGGATAATAAATCTTCTGAAACCATTCATAAAGCTTC
GCGCAGCTCGAGATCTCTTTCAGAACAGGAGTTGTTATTAAAGGATAAGCTTTCTACTTCTCTCTCGCATCCCTTGGCAC
GTCGAAGGTGCATGTTCGAATGGTTTTATAGTGCCATCGACCATCCCTGGTTTGCAAAGATGGAGTTTGTCGATTACCTA
AATCACGTAGGACTTGGTCACATTCCTAGACTTACTCGTCTTGAATGGAGCGTCATTAAAAGCTCTCTTGGTAGACCACG
AAGATTCTCTGAAAGATTTTTACAGGAAGAGAGGGAGAAACTCAAGCAGTACCGTGAGTCTGTGAGAAAGCATTACACAG
AGCTTCGAACAGGTGCAAGGGAAGGGCTTCCTACAGATTTGGCTCGGCCATTAGCAGTTGGGAATAGAGTCATTGCCATT
CATCCCAAAACACGAGAGATTCATGATGGGAAAATCCTCACTGTTGACCATAGCCAATGCAACGTTCTGTTTGACGACTT
GGGCGTTGAGTTAGTTAAGGACATTGATTGTATGCCTTCAAATCCATTGGAATACATGCCAGAGGGTCTGAGGAGGCAAG
TTGATAAGTGCTTGTCCATAAAGAAAGAAGCACAGCTAAGTGGTGTGTCTGTTATATTCCCTCCATGCGGACTTGAGAAT
GTCGACTTCTCCATGAATCAATCTCTGAACCAGGGTGATATGGTTGCTCCCATTCTGCACGGTAAAGTGTTAGCAAGCCC
ACATCAGACTAGTCAGCCATGTATCATAAATTATAGCAAAGGACGAGAAGCTGAGATTCAACGAGTACTTGCACTACAGC
ATGCTTTAGATGAAAAGGAAATGGAGCCTGAGATGATAGAGATTGTCAAGGGTTCAAAGACAAGAGCGCAAGCAATGGTG
GATGCAGCTATCAAGGCTGCATCATCTGTGAAGGAAGGAGAAGATGCCATCAAAATGATTCAAGAAGCCTTGGACATGGT
TGGCAAACATCAGCCGTTGCGCAGCTCTGTGGTCAAACATGAAGAGCATGCAAACGGCGGCGTAGGGCATCATCAAAACC
CATCTCCCTCCTCAGACGCATCAAAGCCTGTGGCTAACAACGATTTCATCTCGCAAGATGGTTCAGAGAAAAACGAGGCT
CAAATGCCTTCAGAGCTAGTCACATCCTGTGTTGCCTCTTGGCTCATGATTCAGATGTGTACGGAGAGGCAGTACCCTCC
ATCTGATGTGGCACAGCTTATAGACACGGCAGTTACAAGCTTGCAGCCTCGATGCCCGCAGAACCTACCGATCTACAGAG
AAATCCAAATGTGTATGGGACGAATCAAGACTCAAATCCTCTCTCTAGTACCAAGTTGA