Details for Kale Locus Bo5g145430

Position : C5 ( 5`- 45082017 .. 45090472 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g145430

Protein [Map View]
MEKGLLLTNKEETARTTLLLVFSTFIIVCASFTFGVSAGYTADTMSSIMTDLDLSLAQFSLFGSLMTFGGMIGAIFSAKA
ASALGNKMTLWLADLFCITGWVAIALAKDIVLLDLGRFFVGIGVGLISYVVPVYVAEITPKHIRGAFTFSNQLLQNCGVA
IAYYFGNFLSWRSLALIGIIPCGIQVIGLFFIPESPRWLAKKGRDEEVEVVLQRLRGKGHDIMFEARAIKISVEVSKQNS
NTSIRSLFRKRYAHQLTIGIGLMLLQQLCGMSGIGSYGSTLFELGGFSARIGMTVLSLIVASAFGLCLSCITLAVAFGVK
DVPEIQNITPVFTFIGILSFTMMFAFGMGALPWVIMSEIFPMDIKVLAGSLVTIANWFTGWIANYCFNFMLVWSPAEMSL
KLYFSLHSSSLKSAKPSSILIAQQSPGDRKTSPADEFSPLAEKFNRRLLLGIGSSSVLAIGANFGGVTSFVLGLSPEFGR
NLQLDVVYPIRGYSRCIDTVEGFEFIYPATWVGDQTLLYRAAEKTERETSLDLPPARISRRKNVNEPVVAFGPPGSTGEL
NVSVIVSPVSPTFSIEAFGGPKEVGEAIVKTVTRSGQRTDLKGTLLEANLRQDSERNLKYYELEFKVESPSFRRHNVAVC
CANGGRLYTLNAQAPESAWSELKHEFHTIAKSFNIIS*

DNA
ATGGAGAAAGGATTACTACTGACAAATAAGGAAGAGACGGCAAGAACAACTCTGCTTCTTGTCTTCTCAACCTTCATCAT
TGTCTGCGCCTCTTTCACCTTTGGCGTTTCCGCGGGATATACTGCAGATACAATGTCCTCCATTATGACAGACTTGGATC
TTTCTCTAGCACAATTTTCACTGTTTGGTTCACTCATGACATTTGGAGGAATGATCGGTGCTATATTCAGCGCCAAAGCT
GCATCTGCCTTGGGTAATAAAATGACGTTGTGGCTTGCCGATTTATTCTGCATAACTGGTTGGGTTGCAATTGCACTAGC
CAAGGATATCGTTTTGCTCGATTTAGGAAGATTTTTTGTTGGAATTGGAGTTGGTCTCATTAGCTATGTGGTTCCTGTAT
ATGTTGCAGAGATAACACCCAAGCATATTAGAGGCGCTTTTACATTTAGCAATCAGTTGTTGCAAAACTGTGGAGTAGCA
ATCGCATATTACTTTGGAAATTTCTTGTCATGGAGAAGTCTAGCCTTAATTGGTATTATTCCATGTGGGATACAAGTTAT
TGGTTTGTTCTTCATACCTGAGTCTCCAAGATGGCTGGCGAAAAAAGGTCGCGATGAAGAAGTTGAAGTTGTTCTTCAAA
GATTAAGGGGGAAAGGACACGATATTATGTTTGAAGCTCGCGCAATCAAGATTTCCGTAGAAGTTTCAAAACAAAATTCG
AATACCAGCATTCGTAGTCTTTTCAGAAAGAGATATGCTCATCAACTTACAATCGGCATAGGTTTGATGCTTCTGCAACA
ATTATGTGGAATGTCAGGAATAGGCTCTTATGGAAGCACTCTTTTTGAACTTGGCGGATTTTCTGCTCGGATTGGGATGA
CGGTGTTGTCTCTTATCGTCGCTTCGGCATTTGGGTTATGCTTAAGCTGTATTACATTGGCGGTAGCTTTTGGAGTTAAA
GATGTTCCCGAGATTCAAAACATTACTCCAGTTTTCACTTTCATCGGAATATTGTCATTCACGATGATGTTTGCATTTGG
AATGGGAGCGTTGCCATGGGTTATAATGTCTGAGATATTTCCAATGGATATAAAGGTGTTAGCAGGGAGTTTAGTGACCA
TAGCCAATTGGTTCACTGGTTGGATTGCCAACTATTGTTTCAATTTTATGTTGGTTTGGAGCCCAGCCGAAATGTCTCTA
AAACTTTACTTCTCTCTTCACTCATCATCACTCAAAAGTGCCAAACCCTCCAGCATTTTGATCGCTCAACAATCCCCCGG
TGACCGGAAAACCTCCCCGGCCGACGAGTTCTCTCCCCTTGCTGAGAAATTCAACCGGCGGTTACTTCTTGGTATAGGCT
CGTCCTCTGTGCTCGCCATCGGTGCGAATTTTGGAGGAGTCACGAGCTTTGTACTCGGTTTATCGCCAGAGTTCGGTCGG
AATCTTCAACTCGATGTTGTGTATCCGATCAGAGGTTATAGCAGATGTATCGACACGGTTGAAGGTTTCGAGTTTATATA
TCCGGCTACGTGGGTTGGAGACCAAACGCTCTTGTATAGAGCCGCGGAGAAGACAGAGCGGGAGACTTCTCTAGACCTTC
CTCCCGCAAGAATCAGTCGCCGGAAAAACGTCAATGAACCGGTTGTTGCATTTGGACCACCCGGTTCGACCGGCGAGCTC
AACGTCAGTGTTATTGTCTCCCCTGTCTCACCCACTTTCTCAATTGAAGCATTTGGAGGGCCAAAGGAAGTAGGAGAAGC
GATAGTAAAAACAGTGACAAGATCTGGTCAAAGAACAGATTTAAAAGGGACTTTGCTGGAAGCAAATCTCAGACAAGATT
CAGAGAGAAACTTGAAGTACTATGAGTTGGAATTCAAAGTCGAATCACCATCTTTCCGGCGGCATAACGTGGCTGTATGT
TGCGCTAATGGTGGCCGGCTCTATACTCTGAATGCTCAGGCTCCAGAGTCAGCTTGGTCAGAGTTAAAACATGAGTTTCA
TACTATTGCTAAATCATTCAATATCATTTCTTAA