Details for Kale Locus Bo5g145420

Position : C5 ( 5`- 45076745 .. 45081360 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g145420

Protein [Map View]
MAMARATSGPAYPERFYAAASYAGFDGSESSAKNVSSKFSNDTALLLYALYQQVTVGPCNTPKPSAWRPVEQSKWKSWQG
LGTMPSMEAMRLFVKILEEDDPTWYSRASKDIPDPVVDVQINQTTKDEPVVENGNSFSETKTISAENGGLAETQDKDVVS
EDPNTVSVYNQWTAPQTSGQRPKARYEHGAAVIQDKMYIYGGNHNGRYLGDLHVLDLKSWTWSRVETKVATESEETSPTL
LSPCAGHSLIPWDNKLLSIGGHTKDHSESMQVKVFDTHTSTWSMLKTYGKPPVSRGGQSVTVVGKTLVIFGGQDAKRSLL
NDLHVLDLETMTWDEIDALGVSPSPRSDHAAAVHAERYLLIFGGGSHATCFDDLHVLDLQTMEWSRPAQQGEVPTPRSGH
AGVTIGENWFIVGGGDNKSGASESVVLNMSTLTWSVVTSVQGRVPLASEGLSLVVSSYNGEDVLVAFGGYNGRYNNEVNL
LKPSHKSTLQQKTLEAPLPVSLSAVNNATTRDIESEVEVSQESRVREIVMDNVNPGTKVEGNNERIIETLKAEKEELELS
LNKEKMQTLQLRQELADGESRNADLYKELHSVRSQLATEQSRCFKLEVDVAELRQKLQTLETLQKELELLQRQKAASEQA
AMNAKRQSSGGVWGWLAGSPQEKDDSP*

DNA
ATGGCTATGGCTAGAGCAACATCTGGCCCCGCCTACCCGGAGAGGTTCTACGCCGCCGCGTCTTACGCCGGATTCGACGG
ATCTGAATCGTCGGCGAAAAACGTCAGCTCGAAATTCTCCAATGACACTGCACTGCTTCTCTATGCGCTCTACCAGCAGG
TTACCGTAGGACCATGCAACACTCCGAAACCTAGCGCATGGAGACCAGTGGAGCAAAGCAAGTGGAAAAGTTGGCAGGGG
CTCGGAACCATGCCTTCCATGGAGGCAATGCGTCTCTTTGTGAAAATTCTGGAGGAAGACGATCCTACCTGGTATTCGAG
GGCATCTAAAGATATCCCAGATCCTGTCGTAGATGTCCAAATCAATCAGACAACAAAAGATGAGCCTGTTGTTGAGAATG
GGAACTCATTTAGCGAGACAAAGACAATTTCTGCTGAGAATGGAGGTTTGGCAGAAACCCAAGACAAAGATGTAGTCTCG
GAAGACCCAAATACTGTTTCTGTATATAACCAGTGGACTGCACCCCAAACATCAGGCCAGCGGCCAAAAGCCCGTTATGA
GCACGGAGCAGCAGTTATTCAAGATAAAATGTATATATATGGTGGAAATCACAATGGCCGTTACCTTGGTGATCTTCATG
TTCTAGATTTAAAAAGTTGGACTTGGTCAAGAGTTGAAACCAAGGTTGCAACTGAATCAGAGGAAACCTCACCGACCTTA
CTATCTCCTTGTGCTGGTCATTCTTTGATACCGTGGGACAACAAATTGCTGTCCATCGGTGGTCATACTAAGGATCACTC
AGAATCTATGCAAGTGAAGGTCTTTGATACGCATACCTCTACATGGTCAATGTTGAAGACATATGGAAAACCACCGGTTT
CACGTGGAGGCCAGTCAGTCACAGTCGTCGGTAAAACTTTGGTGATATTTGGTGGCCAAGATGCGAAGAGATCACTTCTG
AACGATTTGCATGTACTCGACCTAGAAACTATGACCTGGGATGAGATAGATGCCCTAGGTGTGTCTCCGTCTCCGAGGTC
TGATCATGCTGCTGCAGTGCACGCAGAACGTTACCTTCTTATCTTTGGTGGGGGCTCACATGCTACCTGTTTCGATGATC
TGCATGTCCTTGATTTGCAGACTATGGAGTGGTCAAGACCAGCACAACAAGGTGAGGTACCAACTCCTCGATCTGGACAT
GCTGGCGTGACAATTGGGGAGAACTGGTTTATTGTTGGTGGCGGTGATAACAAGAGTGGGGCATCTGAAAGTGTTGTACT
AAACATGTCAACTCTTACATGGTCGGTAGTGACTTCAGTTCAAGGACGTGTACCTCTTGCTAGCGAGGGATTAAGTTTAG
TCGTTAGTTCATACAATGGTGAAGATGTGCTAGTTGCTTTTGGTGGATACAATGGACGTTACAACAACGAGGTTAATCTG
CTTAAGCCAAGCCACAAATCAACACTTCAACAAAAGACTCTAGAAGCGCCTTTGCCAGTTAGTCTCTCTGCTGTTAACAA
CGCCACGACCAGAGACATCGAGTCAGAGGTTGAGGTGAGCCAAGAAAGCAGAGTGCGGGAAATTGTCATGGACAACGTTA
ACCCTGGAACAAAGGTTGAAGGAAACAACGAACGCATTATCGAGACTCTTAAAGCCGAGAAGGAAGAACTGGAGTTATCA
CTGAACAAGGAGAAGATGCAGACTCTCCAACTAAGGCAAGAGCTAGCAGATGGAGAATCACGAAATGCAGATTTGTACAA
GGAACTTCATTCTGTCCGTAGCCAACTTGCAACCGAACAATCAAGATGCTTCAAACTGGAGGTTGATGTTGCGGAGCTAA
GGCAAAAGCTTCAAACACTGGAAACACTACAGAAGGAACTAGAACTCCTGCAGCGCCAAAAGGCTGCCTCTGAACAAGCC
GCAATGAACGCTAAACGACAGAGCTCGGGTGGTGTCTGGGGCTGGCTCGCTGGAAGCCCTCAGGAGAAAGATGATTCGCC
ATGA