Details for Kale Locus Bo5g145380

Position : C5 ( 5`- 45064182 .. 45064797 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g145380

Protein [Map View]
MKNVSFKFVFLVALLSLVFRQDLVEGRTLVPNRGGGNYHDPICNPYDPNCNKPCNPENPNCAMKQGDMDTNRADGNYHDP
PCDPYYDPNCVKPCNPENPNC*

DNA
ATGAAGAACGTTTCCTTTAAATTTGTGTTCTTGGTTGCTCTTCTTTCTCTTGTCTTTCGACAAGATCTTGTGGAGGGTAG
GACATTGGTTCCAAATAGAGGCGGCGGGAATTATCACGACCCGATTTGTAATCCGTATGATCCAAATTGCAACAAACCTT
GTAATCCAGAGAATCCAAATTGCGCCATGAAACAAGGTGACATGGATACAAATAGAGCCGACGGGAACTATCACGACCCG
CCTTGTGACCCGTATTATGATCCAAATTGCGTCAAACCCTGTAATCCAGAGAACCCAAATTGTTAA