Details for Kale Locus Bo5g145370

Position : C5 ( 5`- 45060876 .. 45063864 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g145370

Protein [Map View]
MVYFRQIFLMIIVVAISLQCCSISADERYRTQIGKLVGEDGGEKRKFAVLEKFKALLDLIKPSTPRRRNLAASPWPAPSP
SPYPNGGPVESPAYSPAPQRPIPPHLRRPLPQRTHPPGQHEIQSRKHEKGGVFVPLVVSTACGIGFVVCVVVVLCLCLRV
RKKNGKTLSFKRKQRKSQKVSINPTLDFLYLNSVGVDLERQSSVPVKETENDDELREEEVKTSMETEILLDSDNAGSYST
KEIVSVQENGDDKTEHSVSASEEDDESFHSVGGGSQYSNPRLSNASSSSVSGIGSSQRFSERELDIPEHSGISHPPPPPP
PPLPHFSNRGLLHTLSSQETAKPQTLSSQLSAKVSASSSKPLPPPPPPPPRSLQQPQVTNKTPPPPLSLDFSQRTPLGKD
GAPLPKLKPLHWDKVRATPDRTMVWDKIRTSSFEFDEEMIESLFGYTMQTSTKNEDGRCKTPSPGKHLLEPKRLQNFTIL
LKALNATADQICSALGKGEGLCLQQLEALVKMVPTKEEELKLCSYKGAVDELGSAEKFLRALVGVPFAFQRAEAMLYRET
FEDEVVHLRNSFSMLEEACKELKSSRLFLKLLEAVLKTGNRMNVGTIRGGAKAFKLDALLKLSDVKGTDGKTTLLHFVVQ
EISRSEGIRVSDSIMGRIMNQRPNKNRTAEEKEEDYRRMGLDLVSGLNTELRNVKKTATIDLEGLVSSVSNLRDGLEQLR
CLASNEENRAFVSSMNSFLRYGEKSLEELREDEERIMERVGEIAEYFHGDVRGDDKNPLRIFVIVRDFLGMLDQVCRELR
CVRVPNSPSPLAPFR*

DNA
ATGGTTTACTTTCGTCAGATCTTTCTCATGATCATTGTAGTGGCAATATCATTACAATGCTGTAGCATTTCTGCTGATGA
GAGATACCGGACCCAGATCGGAAAACTCGTCGGAGAAGACGGTGGCGAGAAGAGAAAGTTCGCGGTTTTGGAAAAGTTCA
AAGCTTTACTCGATTTGATCAAACCCTCTACTCCCCGGCGAAGAAACCTCGCCGCGTCTCCTTGGCCGGCTCCGTCGCCG
TCTCCGTATCCAAACGGTGGTCCAGTGGAGTCTCCGGCGTACTCTCCAGCTCCTCAGCGGCCAATCCCGCCGCATCTCCG
TCGTCCGTTGCCTCAACGGACGCATCCGCCGGGACAACACGAGATTCAGAGTCGGAAACACGAGAAAGGTGGAGTTTTTG
TACCTCTGGTCGTTTCAACGGCTTGTGGGATCGGTTTCGTGGTTTGCGTAGTTGTGGTGCTCTGTCTCTGCTTGAGAGTC
AGAAAGAAGAACGGTAAAACGCTGTCGTTTAAACGGAAACAGAGGAAGTCTCAGAAGGTTAGCATAAACCCGACTCTCGA
CTTCTTGTATTTAAACTCGGTCGGTGTCGATTTGGAGAGACAGAGCTCTGTTCCCGTTAAAGAAACGGAGAATGATGATG
AGTTGCGTGAAGAAGAGGTTAAGACAAGCATGGAAACGGAGATTTTATTAGATTCGGACAATGCTGGTAGTTACTCAACG
AAAGAGATTGTGTCGGTGCAAGAAAATGGTGATGATAAAACAGAGCACTCTGTTTCTGCTTCAGAGGAGGATGATGAGTC
TTTTCATTCAGTTGGTGGTGGCTCTCAGTATTCAAATCCAAGACTCTCGAACGCTTCTTCTTCCTCTGTCTCTGGTATTG
GATCCTCTCAACGCTTCTCAGAACGGGAACTAGATATTCCTGAGCATTCAGGAATATCTCATCCGCCGCCGCCACCACCA
CCACCGCTTCCGCATTTTTCAAACAGAGGACTTCTTCACACTCTGTCTTCGCAGGAAACGGCTAAACCGCAGACGCTTTC
GTCGCAGTTATCAGCAAAAGTTTCTGCTTCATCCTCTAAACCTCTGCCGCCACCACCGCCGCCGCCGCCACGGTCGCTAC
AACAACCTCAAGTAACGAACAAGACGCCGCCGCCTCCTCTGTCTCTTGATTTCTCTCAACGTACACCGTTAGGTAAAGAC
GGAGCTCCGTTACCTAAGCTGAAACCACTTCACTGGGATAAAGTGAGGGCTACACCGGACCGGACCATGGTCTGGGATAA
GATCAGAACTAGCTCTTTTGAATTCGATGAAGAGATGATCGAGTCTCTATTTGGGTATACAATGCAAACCTCCACTAAGA
ACGAAGACGGGAGGTGTAAGACTCCATCGCCAGGGAAACACCTTCTTGAACCTAAAAGACTTCAGAACTTTACCATTCTA
TTGAAAGCTCTAAACGCAACGGCTGATCAAATCTGCTCTGCCTTGGGGAAAGGGGAAGGCTTGTGTCTACAGCAACTAGA
AGCATTGGTGAAGATGGTACCTACTAAAGAAGAAGAATTAAAGCTGTGTAGCTACAAAGGAGCAGTAGATGAGCTTGGCT
CGGCTGAGAAATTTCTCAGGGCGCTTGTGGGAGTTCCATTTGCGTTTCAAAGAGCTGAAGCAATGCTTTATAGAGAAACG
TTTGAAGACGAAGTGGTTCATCTCAGAAACTCCTTCTCAATGCTTGAGGAAGCTTGCAAGGAGCTGAAGTCAAGCAGATT
ATTCCTGAAGCTTCTAGAAGCTGTCCTCAAGACTGGTAACAGGATGAATGTAGGAACCATACGCGGCGGCGCAAAAGCCT
TCAAGCTTGACGCTCTCCTCAAGCTATCTGATGTAAAGGGCACAGATGGGAAGACAACTCTGCTCCACTTCGTCGTGCAA
GAGATATCTAGGTCCGAGGGAATCAGGGTTTCAGACAGCATCATGGGACGGATTATGAACCAGAGACCAAACAAAAACAG
AACAGCCGAGGAGAAAGAGGAGGATTACAGAAGGATGGGGCTAGATCTCGTCTCGGGTCTTAACACTGAGCTACGTAACG
TGAAGAAGACGGCAACGATTGATCTTGAAGGACTCGTTAGCTCGGTGTCGAATCTGAGAGACGGGCTAGAGCAGTTGAGG
TGTCTAGCGAGCAACGAAGAGAACAGAGCGTTTGTTAGTTCGATGAACTCGTTCTTGAGATACGGAGAGAAGAGCTTGGA
GGAGTTGAGGGAAGACGAGGAGAGGATTATGGAGAGGGTTGGAGAGATCGCTGAGTATTTTCACGGAGACGTGAGGGGAG
ATGACAAGAACCCGTTGAGGATCTTTGTGATTGTTAGGGATTTTCTTGGGATGTTGGATCAAGTCTGTAGAGAGCTGAGG
TGTGTTAGGGTTCCCAACAGCCCTAGCCCTTTGGCTCCATTTCGATGA