Details for Kale Locus Bo5g145350

Position : C5 ( 5`- 45044473 .. 45045592 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g145350

Protein [Map View]
MNSRAIYAVVAILAIVISAVNASVGDFGGSLDFVRAGSSSLFSGCKGSIAECIAEEEEMEFDSDISRRILAQKKYVSYGA
MRKSSVPCSRRGASYYNCQRGAQANPYRRGCSTITRISGGKSRLISTRTSIRVRTVIGGKVAKVTQTQDGHSSWSSITTR
PRALGYFYKRLSICKD*

DNA
ATGAACTCTCGGGCGATCTACGCCGTCGTAGCCATCCTCGCGATCGTAATCTCAGCCGTCAACGCAAGCGTCGGCGACTT
CGGAGGCTCCCTTGATTTCGTACGAGCCGGATCTTCTTCGCTCTTCTCCGGATGCAAAGGATCCATCGCTGAGTGTATAG
CTGAGGAAGAGGAGATGGAGTTCGACTCCGATATCAGCCGGCGCATTCTAGCGCAGAAGAAGTACGTTAGCTACGGTGCG
ATGAGGAAGAGCAGTGTGCCTTGCTCGCGCCGTGGAGCTTCGTATTACAACTGCCAGCGTGGCGCTCAGGCGAATCCTTA
CCGCCGTGGATGCAGCACCATCACAAGGATCTCAGGCGGTAAGTCCAGACTAATCTCCACGAGGACTTCCATCCGGGTAC
GCACGGTTATAGGCGGGAAGGTGGCCAAGGTGACTCAAACTCAGGACGGACACTCCAGCTGGAGTTCCATTACCACTAGA
CCAAGAGCTCTTGGTTACTTTTATAAACGGCTTTCCATATGCAAAGATTAA