Details for Kale Locus Bo5g145340

Position : C5 ( 5`- 45041058 .. 45042219 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g145340

Protein [Map View]
MAQTDINQPKLDMTKEEKERLKYLEFVQAAAVEALLRFALIYAKAKDKSGPLKPGVESVEGAVKTVVGPVYHKYHDVPVE
VLKYMDQKVDVSVSELDRRVPPVVKQVSAQAISAAQIAPILARALATEVRRAGVVETASGVAKSVYTKYEPAAKELYASY
EPKAEQCAVSAWKKLNQLPLFPRLAQVAVPTAAFCSEKYNDTVVMAAEKGYRFTSYMPLVPTERISKIFGDEKTETKPLE
FHPLD*

DNA
ATGGCACAAACCGATATCAATCAGCCGAAACTAGATATGACAAAGGAGGAGAAAGAGAGGTTGAAGTATTTGGAGTTCGT
GCAAGCTGCTGCTGTTGAAGCATTGCTTCGCTTTGCTCTCATTTACGCAAAGGCTAAGGACAAGTCTGGTCCTTTGAAAC
CAGGTGTTGAATCCGTTGAAGGAGCTGTCAAGACTGTGGTCGGTCCTGTCTACCATAAGTACCACGACGTCCCCGTCGAG
GTTCTTAAATACATGGACCAGAAGGTTGACGTGTCTGTGAGTGAGCTTGACCGCCGCGTCCCACCAGTGGTCAAACAAGT
GTCTGCACAAGCCATCTCAGCTGCTCAGATAGCACCCATCTTGGCTCGTGCTTTAGCCACTGAGGTTCGACGTGCTGGCG
TTGTGGAAACCGCATCTGGGGTGGCTAAATCCGTCTACACCAAGTACGAGCCTGCCGCTAAGGAGTTGTACGCAAGCTAC
GAGCCAAAAGCGGAGCAGTGCGCAGTTTCGGCTTGGAAGAAGCTGAACCAGCTTCCTCTGTTCCCGAGGCTGGCTCAGGT
AGCTGTACCAACGGCTGCTTTCTGCTCTGAGAAGTATAATGATACGGTGGTGATGGCTGCAGAGAAAGGGTACAGGTTCA
CATCGTACATGCCTTTGGTTCCAACAGAGAGGATCTCAAAGATCTTCGGGGACGAGAAGACTGAGACTAAGCCGTTGGAG
TTTCATCCTCTTGATTGA