Details for Kale Locus Bo5g145320

Position : C5 ( 5`- 45014641 .. 45016989 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g145320

Protein [Map View]
VFLKEKNIFNYFLSSSLLNNRSSEPPPQTLLRRSLSLSLRLEAIEMATPMVEDTSSFEEDQLASMSTEDIVRATRLLDNE
IRILKEDAQRTNLECDSYKEKIKENQEKIKLNKQLPYLVGNIVEILEMNPEDDAEEDGANIDLDSQRKGKCVVLKTSTRQ
TIFLPVVGLVDPDSLKPGDLVGVNKDSYLILDTLPSEYDSRVKAMEVDEKPTEDYNDIGGLEKQIQELVEAIVLPMTHKE
RFEKLGVRPPKGVLLYGPPGTGKTLMARACAAQTNATFLKLAGPQLVQMFIGDGAKLVRDAFQLAKEKAPCIIFIDEIDA
IGTKRFDSEVSGDREVQRTMLELLNQRDGFSSDERIKVIAATNRADILDPALMRSGRLDRKIEFPHPTEEARARILQIHS
RKMNVHPDVNFEELARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA*

DNA
GTTTTCCTCAAAGAAAAAAATATATTTAATTATTTTCTCTCGTCTTCTCTTCTCAATAATCGCTCTTCAGAACCTCCTCC
CCAAACTCTCCTCCGGCGATCTCTGTCTCTCTCTCTCCGATTAGAGGCTATTGAGATGGCAACTCCGATGGTAGAAGACA
CGTCAAGCTTCGAAGAGGATCAGCTCGCGTCCATGTCCACCGAAGACATCGTTAGAGCTACTCGTCTCCTCGACAACGAG
ATTCGAATTCTCAAGGAAGACGCACAAAGAACAAATCTTGAATGCGATTCTTACAAGGAGAAGATAAAGGAGAATCAGGA
GAAGATTAAACTCAACAAGCAGCTTCCTTACTTGGTTGGCAACATTGTAGAGATCTTGGAGATGAATCCTGAAGACGATG
CTGAGGAAGACGGTGCTAATATTGACCTTGACTCGCAACGGAAGGGGAAGTGTGTTGTGTTGAAAACCTCTACACGACAG
ACAATCTTTCTACCGGTTGTCGGCCTGGTGGACCCAGATAGCCTAAAGCCTGGTGATTTGGTTGGAGTGAATAAAGACAG
TTACTTGATACTGGACACCTTGCCATCAGAGTATGACTCCAGGGTTAAAGCCATGGAGGTCGATGAGAAACCTACCGAAG
ATTACAATGACATTGGAGGACTAGAGAAGCAGATCCAAGAGCTTGTAGAGGCAATTGTGCTCCCCATGACGCACAAGGAG
CGTTTCGAGAAGCTGGGTGTTCGTCCACCGAAGGGAGTGCTTTTGTATGGTCCTCCAGGAACTGGTAAAACTTTAATGGC
ACGTGCCTGTGCAGCACAGACCAATGCCACATTCCTAAAATTGGCAGGTCCTCAATTGGTCCAGATGTTTATCGGAGACG
GAGCAAAACTTGTCCGTGATGCGTTTCAGCTAGCGAAAGAGAAAGCTCCTTGCATCATCTTCATAGATGAAATCGATGCC
ATTGGTACCAAGCGTTTTGACAGTGAAGTAAGTGGAGATAGGGAAGTGCAGAGGACTATGTTGGAGCTGCTCAACCAGCG
TGATGGATTCAGTAGCGATGAGCGTATTAAGGTTATAGCAGCCACTAACCGTGCAGATATTCTGGACCCAGCGCTCATGC
GTTCTGGTCGATTAGACAGGAAGATTGAGTTCCCACATCCAACAGAAGAAGCAAGAGCCAGAATCTTGCAGATCCACTCG
AGGAAGATGAATGTACACCCAGACGTCAACTTTGAGGAGCTTGCAAGATCGACAGATGATTTCAATGGCGCTCAACTGAA
AGCAGTATGTGTAGAGGCTGGCATGTTAGCTCTTCGTCGTGATGCCACAGAGGTGAACCATGAGGACTTCAATGAAGGTA
TCATCCAAGTCCAGGCCAAGAAGAAAGCAAGTTTGAACTACTACGCCTAA