Details for Kale Locus Bo5g145310

Position : C5 ( 5`- 45009364 .. 45011661 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g145310

Protein [Map View]
MGLGNKLNKFNFGDTDLAHEGGADDGGDPRGDEGDGFGSVACSICLDTVAKEGDRAWANLQCGHQFHLDCIGSAFNAKGV
MQCPNCRKIEKGQWLYANGCRSHPEFNVEDWVHEEEFFDIGGYSEVAFGVHWCPFGSSARLPSFNDAEFSPSSYHDLFGQ
QGYFTEPAAPTAGHPCPYVTYIGPVHSSSSSTGGAAGVSESSTFTWNTGSSVSSEVPAPYGFPVDPHYHSWDYHSPPPPP
QQHFSLSVPNVGSPTQPTPPPAAARTSRANGPRPPQFMRPSYHGQTHSSSGRAGSSVAPPFPGSNARTRDRTQALQAYYQ
QSTAQSHQQPDSPVVSRGPVFPSGRRPSRGSTSSSSDQAGGSGFLRFNIWEREPYMPLQQAYPVNQMDREPSIWTSSFNE
GSGSFLQRHGGGGGSS*

DNA
ATGGGTTTAGGCAATAAGCTTAACAAATTCAATTTCGGCGATACTGATCTCGCCCACGAAGGTGGTGCCGACGATGGAGG
AGATCCTCGTGGCGACGAAGGAGATGGCTTTGGCTCGGTTGCGTGTTCGATTTGTCTCGATACGGTCGCTAAAGAGGGCG
ATCGAGCTTGGGCTAATCTTCAATGTGGCCACCAGTTTCATCTCGATTGTATTGGCTCAGCTTTCAATGCAAAGGGGGTG
ATGCAGTGCCCAAACTGTCGGAAAATAGAGAAAGGCCAGTGGCTTTACGCAAACGGTTGCCGTTCACACCCTGAATTTAA
TGTCGAGGATTGGGTTCATGAAGAGGAGTTTTTTGATATCGGAGGATACTCTGAAGTGGCTTTTGGAGTTCATTGGTGCC
CATTTGGAAGTTCAGCGCGTCTTCCTTCTTTCAATGATGCAGAATTTTCGCCGAGTTCATATCACGATCTTTTCGGCCAG
CAAGGTTACTTTACAGAACCAGCAGCGCCAACAGCGGGTCACCCATGCCCGTATGTAACCTACATCGGCCCGGTTCATTC
GTCTTCCTCAAGCACTGGAGGTGCCGCTGGAGTTTCAGAGAGTTCAACTTTCACTTGGAACACCGGCTCATCGGTTTCCA
GTGAAGTCCCAGCTCCTTATGGCTTCCCTGTGGATCCGCACTACCACAGCTGGGATTATCACTCCCCTCCACCTCCACCG
CAACAGCACTTCTCCCTTTCTGTCCCAAACGTGGGCAGTCCAACTCAGCCCACTCCTCCACCAGCTGCTGCAAGGACTTC
CCGTGCCAACGGACCAAGACCGCCGCAGTTCATGCGTCCATCATATCATGGTCAAACTCACAGTTCTAGTGGTAGAGCTG
GGAGCTCGGTGGCGCCGCCTTTTCCGGGAAGCAACGCACGGACACGAGACAGAACGCAAGCTCTTCAAGCCTATTACCAA
CAGTCTACTGCACAGTCACACCAACAGCCTGATTCTCCTGTAGTCTCTCGTGGGCCTGTATTCCCCTCTGGACGGAGGCC
CAGTAGAGGATCAACTTCTTCATCTTCGGATCAGGCAGGGGGGAGCGGGTTTCTCCGGTTTAACATATGGGAGAGGGAGC
CTTATATGCCGTTGCAACAGGCTTACCCGGTTAACCAGATGGACAGAGAACCATCCATTTGGACATCTTCTTTCAATGAA
GGGTCAGGAAGCTTCCTTCAGAGGCATGGCGGCGGAGGAGGATCATCGTAA