Details for Kale Locus Bo5g145260

Position : C5 ( 5`- 45000122 .. 45001385 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g145260

Protein [Map View]
MTTTMTTEGMMMEISMVDDIIRRLLEGKGGKQVQLSEIEIRQLCVNARQIFLSQPNLLDLHAPIRICGDIHGQYQDLLRL
FEYGGYPPSANYLFLGDYVDRGKQSLETICLLLAYKIRYPSKVFLLRGNHEDAKINRIYGFYDECKRRFNVRLWKVFTDC
FNCLPVAALIDDKILCMHGGLSPELENLEQIREIQRPTEIPDNGLLCDLLWSDPDQKHEGWCDSDRGISCTFGADVVAEF
LDKNDLDLICRGHQVVEDGYEFFAKRRLVTIFSAPNYGGEFDNAGALLSVDQSLVCSFEILKPAPSSSSIPLKKVPKMGK
S*

DNA
ATGACGACGACGATGACAACAGAAGGGATGATGATGGAGATAAGTATGGTGGATGACATCATCAGAAGATTATTAGAAGG
CAAAGGAGGCAAACAGGTCCAGCTCTCAGAGATCGAGATCCGTCAACTCTGCGTTAACGCCAGACAAATCTTCCTCTCTC
AGCCTAACCTCCTCGATCTCCATGCCCCCATTCGCATCTGCGGTGATATTCATGGACAATACCAAGACCTTCTCCGTCTA
TTCGAATACGGAGGCTACCCTCCTTCAGCCAACTACCTCTTCCTCGGCGACTACGTCGACAGAGGCAAGCAGAGCCTCGA
GACGATCTGCCTCCTCTTGGCTTACAAAATCCGCTACCCGTCCAAGGTCTTCCTCCTGAGAGGCAACCACGAGGACGCGA
AGATCAACAGGATATACGGCTTCTACGACGAATGCAAACGGAGGTTCAACGTCAGGCTGTGGAAGGTATTCACCGACTGC
TTCAACTGTCTGCCCGTTGCCGCCCTCATCGACGACAAGATCTTGTGTATGCACGGGGGGTTGTCGCCGGAGCTGGAGAA
TTTGGAGCAGATTCGGGAGATTCAGAGGCCTACTGAGATTCCGGACAACGGTCTTCTTTGTGATTTGCTTTGGTCTGATC
CGGATCAGAAGCATGAAGGATGGTGTGATAGCGATAGAGGTATCTCGTGTACGTTTGGAGCTGATGTTGTCGCTGAGTTC
TTGGATAAGAATGATCTCGACCTCATCTGCCGTGGCCATCAAGTGGTGGAAGATGGGTACGAGTTTTTCGCGAAAAGGAG
ATTAGTGACGATATTCTCTGCTCCAAACTATGGTGGAGAGTTTGACAATGCAGGTGCATTACTGAGCGTGGACCAATCTC
TTGTTTGTTCTTTTGAGATTCTGAAACCTGCCCCATCTTCAAGCAGTATCCCTCTCAAGAAGGTACCTAAAATGGGAAAG
TCTTGA